SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002403 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002403
Domain Number 1 Region: 201-262
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000222
Family FF domain 0.0000643
Further Details:      
 
Domain Number 2 Region: 262-322
Classification Level Classification E-value
Superfamily FF domain 0.0000000000209
Family FF domain 0.0046
Further Details:      
 
Domain Number 3 Region: 89-126
Classification Level Classification E-value
Superfamily WW domain 0.000000185
Family WW domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002403   Gene: ENSMPUG00000002429   Transcript: ENSMPUT00000002452
Sequence length 340
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896929.1:991366:1163324:1 gene:ENSMPUG00000002429 transcript:ENSMPUT00000002452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVDPEGLGGPSPSSVQPCHFLTLAPIKIPLRTTPFSDRSREHSRAPGPPALMLHAERK
SPAGPGEDKEPPSILVTREDSAAEGNRPVASTPVPGSPWCVVWTGDDRVFFFNPTMQLSV
WEKPLDLKNRGDLNRIIEDPPHKRKLEAPTPDHSDGSQSEDGRGDRNLRTKRNRTEGHGS
PGPEEAEGQDKGAGTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYL
LLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYG
RDQRFRLVQKKKDQEHFFNQFILILKKRDKENRLRLRRMR
Download sequence
Identical sequences M3XTK3
ENSMPUP00000002403 ENSMPUP00000002403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]