SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002416 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002416
Domain Number 1 Region: 406-529
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-36
Family DEP domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-23
Family DIX domain 0.0018
Further Details:      
 
Domain Number 3 Region: 228-338
Classification Level Classification E-value
Superfamily PDZ domain-like 3.33e-23
Family PDZ domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002416   Gene: ENSMPUG00000002442   Transcript: ENSMPUT00000002465
Sequence length 718
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:3385833:3403296:1 gene:ENSMPUG00000002442 transcript:ENSMPUT00000002465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTSRSSLRGPRERAPSERSGPAASEHSHRSHHSMASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPTKNFGLFDFL
Download sequence
Identical sequences M3XTL6
ENSMPUP00000002416 ENSMPUP00000002416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]