SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002422 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002422
Domain Number 1 Region: 95-178
Classification Level Classification E-value
Superfamily E set domains 3.64e-20
Family E-set domains of sugar-utilizing enzymes 0.09
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002422
Domain Number - Region: 185-235
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00671
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002422   Gene: ENSMPUG00000002449   Transcript: ENSMPUT00000002472
Sequence length 428
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896929.1:1944267:2060789:1 gene:ENSMPUG00000002449 transcript:ENSMPUT00000002472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTV
NVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDNF
FDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTAL
NEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADI
AEALYSVPRNHNQIPTLGNTPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVS
PRGYVPSSTPQQSNYNTVSTSMNGYGTGAMANLGVPGSPGFLNGSSANSPYGIVPSSPTM
AASSVTLPSNCSGTHSIFSFSPANVISAVKQKSAFAPVVRPQASPPPSCTSANGNGLQAM
SGLVVPPM
Download sequence
Identical sequences M3XTM2
ENSMPUP00000002422 ENSMPUP00000002422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]