SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002427 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002427
Domain Number 1 Region: 463-602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000102
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002427
Domain Number - Region: 244-372
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 43-161
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000301
Family CRAL/TRIO domain 0.013
Further Details:      
 
Domain Number - Region: 376-499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00192
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002427   Gene: ENSMPUG00000002454   Transcript: ENSMPUT00000002477
Sequence length 683
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897039.1:4446473:4562677:1 gene:ENSMPUG00000002454 transcript:ENSMPUT00000002477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASVILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMDELSVTLDYLLSIPSEKCKA
RGFTVIVDGRKSQWNVVKTVVLMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRL
GFEVILVSANKLTRYIEPCQLTEDFGGSLTYDHMDWLNKRLVFEKFTKESTSLLDELALI
NNGSDKGNQQEKERSVDLNFLPSVDPETVLQTGHELLSELQQRRFNGSDGGVSWSPMDDE
LLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQW
GIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLS
DVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLL
EEKLKSVDVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQ
RCEDMVDVRRLKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEK
HRKFVDVAQSTYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHR
LEMAIAFHSNAEKILQDCPEEPEAINDEEQFDEIEAVGKSLLDRLTVPVVYPDGTEQYFG
SPSDMASTAEHIRDRMKLVRRDE
Download sequence
Identical sequences M3XTM7
ENSMPUP00000002427 XP_012920267.1.14098 ENSMPUP00000002427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]