SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002432 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002432
Domain Number 1 Region: 1406-1469
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000173
Family I set domains 0.035
Further Details:      
 
Domain Number 2 Region: 47-127
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000202
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 3 Region: 208-352
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000158
Family Spectrin repeat 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002432
Domain Number - Region: 698-770
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000576
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number - Region: 980-1119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000678
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number - Region: 863-996
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00911
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 133-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.018
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number - Region: 316-450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0248
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002432   Gene: ENSMPUG00000002459   Transcript: ENSMPUT00000002482
Sequence length 1480
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897039.1:4578117:4805042:1 gene:ENSMPUG00000002459 transcript:ENSMPUT00000002482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQGSPDVEFSTTTVSSVAVQAGDSKIVIAVVKCGKWVQLQLAESQPNLLEIGSNQDDT
KKLLHDHELLLGKLKALEDQVWELLQEADKTAEENKDRSQVYDAMANTLGEAWAALVSML
ERRRELLRLTSEFFENALEFAIKIDQAEDFLQNTQEFESAESLKSLLQLHEHHTKELLER
SLALLNKSQQLTDFIEKFKCDGPNVNPELIQGAHNSCLKIDSLLELLQDRRRQIDKDLKQ
QQQELRQVLQICQWDQQENQVTCWFQKTLRDLQQQSLGSSLSDNEELICKHEELIIQAKE
WNSAAEKLRSDALGILLSKGYMEKEHLRLSNQKLHQLQGECRQLMAERETWLKKANGFFC
STNKAFDVLGRVEAYLKLLKSEDLSLPVLAARHEELHREIKDCTADALQKGQALISQVDS
CSSRVSGVHEMMRCIQRRVDQLTQQCSAHKEFALKKQQLIASVEGHLKKVEMSIQKISPV
LSNAMDVGSNLSESGKILSKYLELDMQVKETAHELETAAKLMTEKNEFEPDEVALLSSKA
KWLEEELKILGQRISSRSQVLQSYVAFLKSSEEVQEQYQSLKEFYQTEILQKEEDDPEVK
HRSDSAEKQWQLFLKRSFLTQDLGLEFLNLINMAKRDEILNAKSEAHFMENAMESQKVER
EELGHLRITWQLEGIATQPVKQQWGAFKEQLRKTTHNLQLLDEALTPVSALDLGGNLQTI
LGLQKKWNEMKPQLQQLNDEVRYLLRASEELSGKGAPVKEKSQQLRELIHLHQTQEERIQ
DYEDILYKLVQFHQVKEKLGHLHKSRETEFVDQPEDLEDAHEAQVHLSRAQEKQAHVDHL
HKLALSLGVDIISSVQRPNCSNVSAKNLQQQLDLLEGDSGNWRARAQEYERTLTCSLEFC
NTRDSINELKESFKDIKKKFNNLKFNYAKKNEKARNLKALKYQIQQVDVHAEKIQALKKK
MEKVENRTSDSFLSYPNNKVNVLLEAMKDLQEHVDEFDKVVTDYKMTLDLTEHLQEMIEE
CHFWYEDASATVVRVGKYSTECKTKEAVQILHQQFNKYIRPSVPQQEERIQEISDLAQRL
YGFEEGQKFAEKIMAKHKEVLESITELCVSLTELEEKLKQGDILKTNVNLEDLHDDFIDL
LKEPARNTQTLFNEERNKVQGAGDLAINGTGEGQYPQHLKEPPSDREAAVQGQLLPTDTL
SGEEYECVSPDDISLPPLPGSPDPPLGPADMDVEEHASPSLSIHTSSYKMQTGASRPGEA
QALGIPPPAAFADTYNDERETFSSHFERPYPQFKAELPLTSRGFLEKSTAFCTIRAKHPE
SMPSDVHERASQQHPQAQGRLLETREKVHVSDNITKPQDRLHASQDAFPGLGFLSDPGRA
YQRQMVPKDEIKCTSAKNTVVSLAGQAPNFSRLLSNVTVTEGSPVTLEVEVTGFPEPTLT
WYKKGQKLSADGHLQVLHKETRHSVFIPKLPMIFWGFRKK
Download sequence
Identical sequences M3XTN2
ENSMPUP00000002432 ENSMPUP00000002432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]