SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002450 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002450
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000184
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002450   Gene: ENSMPUG00000002478   Transcript: ENSMPUT00000002501
Sequence length 1580
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896965.1:42192:172418:1 gene:ENSMPUG00000002478 transcript:ENSMPUT00000002501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQIEEGSKAAAVDKLLAGDEIVGINDIDLSGFRQEAICLVKGSHKTLKLVVKRKNEVSW
RPHSWHATKFSDSHPEMAAAPFPPAGACPSWHGQHHTSSSSHDLSGPWEQTNLQRTSDHF
SSLGSVDSLDQPSHHYPSGRLSAAKSNSSIDHLGGQSKRDSAYGSFSTSSSTPDHTLPKA
DASSTENIIYKVGLWEASKPGGSRQGQAASDAPGLEERLGYFPARVPCDSRKSPRPEDSP
EAKLATAGRSNFGPVWYVPEKKKAPSSPPPPPPPLRSDSFAATKSHEKTQGPPFSEAANA
QHFLGLTRAQPRSDWRTEAADPWRPVHPSGRRAVGSSDCVPDVPLDGGVLPSDHRAGGLP
GAPGQLQASLSSTDVRFPPSSHGCQHPRQYSDDSPFSHEGPRAATSLREQPRLAFPGSRQ
EPPAGRFQDDSPPQVRWPSATNQKGDGGGQSRYYCVTSRHCPQGSTQAAWLHEEAWQPDV
VLGAPEYPASHPMGQRPRCSLLQPEVAAGPPERDGSDPGDRGAEGRSVACEDTEGARPVA
KAGARGSADGFAWADGESSQISRQKTPMLHSLTREGTRRPENGQETHTERPPPTDAPGGK
PTRRSDRFATTLRNEIQMRRARLQQSKSTVALTGAGGVAGEAAGWGMQHGAATSATPEGS
FTGTYRDHVKEAQARVLRATSFKRRDLEPSAADPYAGSPEHRAEDHGTGPDPVPRVWEGG
SAKPSPSGAGGPHVPRIGGRKRFTLEQKLKSYSEPEKMNEVGLSGHERPQQHPGTSDETL
GTFADRWKFFEETSRPVQQRPGPNPALCGFPKERLERPQTAGRGYEGAEPWFQKRARTTS
FGEHPSGHGKAGKVGKWEPPQRLGTFAEYQASWREQRPALEGRSSGRYHSADDILDVGLE
QHERPQYVHGRSRSSPSTDLYTQEAAIGPQQSVGDTGERRERSSAVWAEEGQPHPRQADA
QCPEVGSAAQQDPPEPSQEARCRAGTLPRDYRYPEETLGPGPHVPDTPSALHTWGQDPRP
VNTAALPKKPAPQRPPPPKREPRQLKGLAGGLPGAAHLGAPSRPLAPPSPEALEACVDRL
SLSHSPCPLVEKLSSVQPEDGVRAASEHGGRHVDEHAACPKREAPLPSRFRPLPTSAMET
SRSPSPQFAPQKLTDKPPLLIQDENCARIERVADGSGTVKRVPVKIVHSESRPEKESRQG
LARAAELPVLPSGLEKDQIKTLRTSEQSYSRFCLYSREDAEPEPPRPSAPTPGAKDGGAS
PSGLSYLRAKERTAEDLKSEELAREIVGKDRSLAEILDPGVKMRTTMDLMEGIFPKDEHL
LEEAQQRRKLLPKVPSPRGADEKREEPGVPAAMSLATNSTYYSTSAPKAELLIKMKDLQE
QQQEPEDDAGSDVDHDLAVKKQELIESISRKLQVLREARESLLEDIQANSALGDEVEAIA
KDVCKPNEFDKFRMFIGDLDKVVNLLLSLSGRLARVENALNNLDDSTSPGDRQSLLEKQR
MLIQQHEDAKELKENLDRRERVVLDILASYLSEESLADYEHFVKMKSALIIEQRELEDKI
HLGEEQLKCLFDSLQPERAK
Download sequence
Identical sequences M3XTQ0
XP_012915038.1.14098 ENSMPUP00000002450 ENSMPUP00000002450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]