SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002457 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002457
Domain Number 1 Region: 638-762
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000107
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 2 Region: 19-54
Classification Level Classification E-value
Superfamily WW domain 0.0000000186
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002457   Gene: ENSMPUG00000002486   Transcript: ENSMPUT00000002509
Sequence length 1126
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896965.1:272754:344309:1 gene:ENSMPUG00000002486 transcript:ENSMPUT00000002509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILFCRITKPLTFADCVGDELPLGWETVYDKQIGIYYMDHINKLTQIEDPREQWRREQER
MLKEYLIVAQEALNAKKEIYQIKQQRFELAQEEYQQLHRLCEDDSRSHASSFSGYSANTK
YDPYQIKAEIASRRDRLSRLKRELTQMKQELQSKEKGVETLREIDRKMSSTHTSYKPDEA
QAIMTELRTIKKAICTGEKERRDLMQSLAKLTDGFRNSFSLSDPPQDFPHNPGVPGDSLP
QQFCDAGSQTDIIGEFGFDDKTRLVDRVRLNWQYEEARKRVSTIQQQLAQLENESWPGLA
EADRDRLQLIKEKEALLQELQLIVQQRRPAEDVARLEAERRRLEEEIQRARATSVQGATE
RILLQEKRNCLLMQLEEATRLTSYLQSQLKSLSASTLTVSSGSSRGSLASSRGSLASSRG
SLSSVSFTDIYGLPQYEKPDAECGQLLRFDLIPFDSLGRDAPFLDPPVPSAFHKQRRSLD
TPQSLASLSSRSSLSSLSPPSSPLDTPFLPASRDSPLAQLGDGFEVPGLGTLDRLRAQAS
ALGDEDLQGTAALQPHGFLGEGEGPRERGAQATVAPTAAPVTLREDSARRLERRARRVSA
CLSDYSLASDSGVFEPLNKRSEDADESVPGDTCGNEGPQIHVGFLLDSANECLLVNVLQL
KNVAGLVLKEDSKIHIRVYLPPIDSGTPNTYCSKALEFQAPLVFNEIFRIPVHSSMLTLK
SLQLYVCAVTPQLPEELLGIAQINLADYDGSSEMQLRWYAVQVFSSCGPPRARESERLGA
AAGDPAQAATAGKTDAVTALLARTTAQLQAVERELAEERVKLECAEDEILELGRKEELAE
AVSERSWQADSVDSGCSSCAQTSPPHPEPCCVGGDPLHGHAFAGQADPFSPEKLQPPPLK
VDKETNTEDVFPDEVASLPKERPGRRARGSPFVRSSTIVRSQTFSPGARSQYVCRLYRSD
SDSSTLPRKSPFVRNTLERRTLRYKQPCRSSLAELMARTSLDLELDLQASRTRQRQLNEE
ICTLRELRQRLEDAQLRGQTDLPHWVLRDERFRSLLKEAERQTRQTKLDFHQEQAAEKML
KKASRGVCQLRGQNHQEPIQVQTFREKIAFFTRPRINVPPLPADDV
Download sequence
Identical sequences M3XTQ7
XP_004758868.2.14098 ENSMPUP00000002457 ENSMPUP00000002457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]