SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002479 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002479
Domain Number 1 Region: 85-287,336-418,455-480
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.02e-57
Family Diacylglycerol kinase-like 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002479
Domain Number - Region: 7-86
Classification Level Classification E-value
Superfamily PH domain-like 0.0564
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002479   Gene: ENSMPUG00000002508   Transcript: ENSMPUT00000002531
Sequence length 492
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897110.1:2924709:2946201:1 gene:ENSMPUG00000002508 transcript:ENSMPUT00000002531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFDACCVPISEIITVEETDTHGKRYSSGKWQKMEKPFAFTVHCVKRARRRRWKWAQVTF
CCAEEPLCHLWLRVLQELLGALTSRPKHLLVFINPFGGKGQGKRIYERKVAPLFTLASVT
TEVIVTEHANQAKETLYEINTDSYDGIVCVGGDGMFSEVLHGLIGRTQRDAGVDQNQPRA
ALVPSPLRIGIIPAGSTDCVCFSTVGTNDVETSALHIIVGDSLCMDVSSVHHHGALLRYS
VSLLGYGFYGDIIKDSEKKRWMGLARYDFSGLKTFLSHHCYEGTVSFLPARHTVGSPRDR
KPCRAGCFVCRQSRQQLEEEQKKSLYGLENTEEVEEWKVVCGKFLAINATNMSCACPRTP
RGLSPAAHLGDGSSDLILIRKCSRFNFLRFLVRHTNQCDQFDFAFVEVYRVKKFQFLSKH
MEDEDSDLKERGKARFGPVCSDSPPCCCPVSNSSWNCDGEVLSSSSIEVRVHCQLVRLFA
RGIEEDTKEPDH
Download sequence
Identical sequences M3XTS9
ENSMPUP00000002479 ENSMPUP00000002479 XP_012902718.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]