SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002505 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002505
Domain Number 1 Region: 116-165,194-276
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000379
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002505   Gene: ENSMPUG00000002534   Transcript: ENSMPUT00000002557
Sequence length 512
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897110.1:3231009:3255433:-1 gene:ENSMPUG00000002534 transcript:ENSMPUT00000002557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPASLRDCQAWKDAGLPLSTTSNEACKLFDATLTQYVKWTNDRSLGGIEGCLSKLQAA
DPTFAMGHAIANGLVLIGTGSSVRLDRELDQAVKTMVEVSQTQLLTQRERLHVSAVETFA
KGNFSRACELWEQILWDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPSIPLSS
YVKGIYSFGLMETNFYDKAEKLAKEALSINPTDAWSVHTIAHIHEMKAEIKDGVEFMQSS
EAHWKDSDMLACHNYWHWALYLIEKGEYEAALTIYDNHVFPSLKASGAMLDVVDSCSMLY
RLQMEGVSVGERWQEVLPITQKHSRDHILLFNDAHFLMASLGARDSGTTQELLTTLQDAS
KCVPPPAISRQDMAILLGARVAFPSPCWGWKPQCHGCRLPQGARAPGENCQHLLARDVGL
PLCQALVEAENGNPGRVLELLLPIRYRIIQIGGSNAQRDIFNQLLIHAALNCTSGVHKNV
ARNLLMERDALKPNSPLTQRLIRKAAAVHLLQ
Download sequence
Identical sequences M3XTV5
XP_012902724.1.14098 ENSMPUP00000002505 ENSMPUP00000002505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]