SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002508 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002508
Domain Number 1 Region: 559-694
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.83e-40
Family Synaptotagmin-like (S variant) 0.00000034
Further Details:      
 
Domain Number 2 Region: 391-524
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.41e-37
Family Synaptotagmin-like (S variant) 0.003
Further Details:      
 
Domain Number 3 Region: 49-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.44e-34
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002508   Gene: ENSMPUG00000002537   Transcript: ENSMPUT00000002560
Sequence length 702
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:6608752:6708711:1 gene:ENSMPUG00000002537 transcript:ENSMPUT00000002560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTVFSNSSSRWMCPSDRPLQSNDKEQLQAGWSVHPSGQPDRQRKQEELTDEEKEIINR
VIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKK
NVCTKCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQ
PVTEPAVPEQVTPEPKHAARVPSRGDTEDRRGLGQKTGPEPASAPGRGSYGPPVRRASEA
RMSSTSRDSESWDHGHGGAAGDSSRNPAGLRRANSVQASRPAPATMQSPAPPQAAQPGPP
GGSKPGTGPAGRFPDQRPEVAPGDSGYAGATAPPREERTGGVGGYSAVGARDDRAGPPLG
PYSQASAAAPQPAVAPARQPPPPEEEEEEANSYDSDEATTLGALEFSLLYDQDNSSLHCT
IIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLVYHGITDDD
MQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQKKNFNICLERVIPMKRAGTTGSAR
GMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKL
WLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIG
GCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNENHVSSD
Download sequence
Identical sequences M3XTV8
ENSMPUP00000002508 XP_004753328.1.14098 XP_004753329.1.14098 ENSMPUP00000002508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]