SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002522 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002522
Domain Number 1 Region: 252-379
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 381-485
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-24
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 3 Region: 26-118
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-16
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 163-246
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000238
Family Ras-binding domain, RBD 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002522   Gene: ENSMPUG00000002551   Transcript: ENSMPUT00000002574
Sequence length 1281
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896965.1:2496095:2680634:1 gene:ENSMPUG00000002551 transcript:ENSMPUT00000002574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTANRDGRDCFINHMTQGIPFDDPRLESCQILPPAPRRVEMRRDPVLGFGFVAGSEKPVV
VRSVTPGGPSEGKLIPGDQIVMINDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKS
AFISAAKKARLKSNPVKVRFSEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRF
DGSTSIKDVILTLQEKLSIKGIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHK
MRCLFRISFVPKDPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYI
ATVTTKQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKL
SALQAKVHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVAL
LADFSHVNRIEMFTEEDSFVRVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRR
SIFNMANKKNTGTQETGTENKGKHNLLGPDWNCIPQMTTFIGEGEQEAQITYIDSKQKTV
DISDGTLCPKDHRHLYLDNTYNPDELNQPLTQPGDAPCEADYRTLAQRSLLTLSGPETLK
KAQESPRGAKVSFIFGDLALDDGVNPPTLGYERLLEESPELLEKQRSLYMASANDMKGLD
LAPDPESIQFVANSVYANIGDVKNFETAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDL
VVGEMNQPAILNLSGSSDDIIDLTSLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDE
EDSQSQAASFLEDKEPGRGLQGDEIPVSLIDAVPTNAEGKCEKGLDNTVVSTLEALEALS
VSEEQQTSDNSGVAILRAYSPESSSDSGNETNSSEMTESSELAAAQKQSESLSRMFLATH
EGYHPLAEEQTEFPTSRTPAGGLPPQSAHALAARPVTDLPPKVVPSKQILPPDPMEMEPE
TMETKSVTDYFSKLHMGSVVYSCTSKRKSKLADGEGKAPPSANLPGKKQQGTKTAEAEEE
AKGKFGTVSSRDSQHLSTFNLERTAFRKDSQRWYVATEGAVAEKSGLEAATGIPFPRGAG
LGTREAEEKVEGAPDGEASEVSALGQRDHFLTDVTCVSSAKDLDNPEDTDPSTCDHPSKL
PEAEDSVARLCDYHLAKRMSSLQSECHFSLQSSQGSSVDAGCGTGSSSTSATPVESPLCP
AMGKHLIPETSGKGMSYVPSEERASGLPPHGAAFKELHPQAEGMCPRMAVPALHTAINAE
PLFGTLRDGCHRLPKIKETTV
Download sequence
Identical sequences M3XTX2
ENSMPUP00000002522 ENSMPUP00000002522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]