SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002528 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002528
Domain Number 1 Region: 686-770
Classification Level Classification E-value
Superfamily BRCT domain 2.75e-17
Family BRCT domain 0.0091
Further Details:      
 
Domain Number 2 Region: 35-123
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000183
Family DNA ligase 0.035
Further Details:      
 
Domain Number 3 Region: 791-871
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000017
Family BRCT domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002528   Gene: ENSMPUG00000002557   Transcript: ENSMPUT00000002580
Sequence length 872
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897021.1:477153:718014:-1 gene:ENSMPUG00000002557 transcript:ENSMPUT00000002580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVTYSWLARLGAEQRVRLVRSLMAAPVTPGRQVLKDVVAYVEVWSVNGTENYSKTFTN
QLEDMGAKVSKTFNKQVTHVVFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTARAHVDEAL
FPAANTKEHLPSLIKKKRKCMQPKDFIPKTPEHDKRLQKKFEKMATELQRQKRSLDNDVP
VLLFESNGSLMYSPTIKMCSGQHSAMQRRLQEMKKKRENLSPTSSQMLEKSLDNQASSPG
EASWNISHDTLCSDESFAGDLNSSFDDVCGKVRCGSQEAALGGIVDEIVSSPALKTRSIH
SAASPGCLPPLTPQKPMGSPSKEEIRGLGDPAGEVVTPAKQQSEGAAGMVFDEKCSLSPM
LSATKCRPSGQSRSESSSAKRKRRSESLGAPPEERLKKRCGGQPGRPRVRLWTSGHPLPL
PAGPAGETAGCGMSSYDDYFSPDNLRERSSEPLLPGCQPSAGLAQLSRSGGLSQTERRNI
LHMADFSCVGRSPRSVDMTDVTAKMSSSLEKPPQDTADTTWACLTSEGTCAAEGTPGPCQ
QAGAHRRAGPHAGGRRRSHMAGEPAVPQGHGGEGLHGDFTPLEGSSVEMEELLVVRSGQK
EDSTSRMWNSSGGEMQCDRELDLVPDCTVDKAAEGGPQPSSACDGSVKSGPTRHDVLDAS
LEACKDRTRPHEASKRRGKARKPTRTLVMTSMPSEKQNIVIQVVNKLKGFSFAREVCDTT
THVLTGNPLRTLNVLLGIARGCWILSYEWVLWSLELGHWISEEPFELSNYFPAAPLCRLE
RVLSAGRYQGTLFADQPVMFITPASDPPRAKLRELVLLCGGRITRILHQAGIFIGPSQGK
RKATATYLSETWILDSVTQHKVCAFDNYLLPQ
Download sequence
Identical sequences M3XTX8
ENSMPUP00000002528 ENSMPUP00000002528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]