SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002533 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002533
Domain Number 1 Region: 263-611
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-86
Family p120GAP domain-like 0.0000345
Further Details:      
 
Domain Number 2 Region: 567-709
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-35
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Domain Number 3 Region: 126-240
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.21e-29
Family Synaptotagmin-like (S variant) 0.0094
Further Details:      
 
Domain Number 4 Region: 6-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.33e-26
Family PLC-like (P variant) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002533   Gene: ENSMPUG00000002562   Transcript: ENSMPUT00000002585
Sequence length 813
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:6828063:6855510:-1 gene:ENSMPUG00000002562 transcript:ENSMPUT00000002585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSSSLNVRVVEGRALPAKDVSGSSDPYCIVKVDDEVVARTATVWRSLSPFWGEEYTIH
LPLDFHHLAFYVLDEDTVGHDDVIGKISLSREAIAADPRGIDSWINLSRVDPDAEVQGEI
YLDVQMLEDTRGRCLRCHVLQARDLAPRDITGTSDPFARVFWGSQSLETSTIKKTRFPHW
NEVLELREMPGAPAPLRVELWDWDMVGKNDFLGMVEFPPRVLQQNAPRGWFRLLPFPRAE
EDSGGTLGALRLKVRLIEDRVLPSRYYQPLTELLMASVLGPAEEDAASPLAVLEELTLGD
CRQDLATKLVKLFLGQGLAGPFLDYLTRREVARTTDPNTLFRSNSLASKAMEQFMKLVGM
PYLHEVLKPVIHRVFEEKKYMELDPCKMDLGRSRRISFKGAPSEEHVRDASLGLLTGYLG
PIVDAIVGSVGRCPPAMRLAFKQLHQCVKERFPQAEHEDVKYLAISGFLFLRFFAPAILT
PKLFDLRDQHADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQSISRVRH
FLDQLVDVDGEEEAGGPARALVAPSVIVREGYLLKRKEEPASLTTRFAFKKRYFWLSGEA
LSYSKSPEWQMRSSIPVSHIRAVERVDEGAFQLPHVMQVLTQDAAGVLHTTYLQCKNVNE
LNQWLSALRKASAPNPDKLASCHPGAFRSSRWTCCLQAERSAAGCSRTHSAVTLGDWSDP
LDPDAEIQMVYRQLLLGRDQLRMKFQEDPNIDSSPEADAEKGSGATEGVCPDALARHREA
AARLLEVLEDLDRAHEEFQQREQQRAALSPLGH
Download sequence
Identical sequences M3XTY3
ENSMPUP00000002533 XP_012912011.1.14098 ENSMPUP00000002533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]