SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002631 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002631
Domain Number 1 Region: 229-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-62
Family Nuclear receptor ligand-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002631   Gene: ENSMPUG00000002659   Transcript: ENSMPUT00000002685
Sequence length 474
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896981.1:5158745:5163959:1 gene:ENSMPUG00000002659 transcript:ENSMPUT00000002685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEDQQWQGSILYNMLMSAKQTHAAPEAPEARLGGACWGCSCGSEPPVGREGLPGGRAV
TLVYRCCFCGEDHPRQGSILYNMLMSAKQTHAAPEASEARQGGACWGCSCGSEPPVGREE
LSAGRTVALMYRCCFCGEDHPRQGSILYSLLTSAKQTHVAPEAPEARPGGAWWNRSYVAQ
GLGGREELPGGKAVALLYRCCFCGEDHPSPGGIFPHLPTSAKETQGAPETQPAAPWWDPP
CGAQRRVALSSPQVVCEAAAAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLLLEL
AQDRLNLETVETSETSEPSQLQKILTTRRRETGGDEPPPLPPRQPPLVSPPEAGRLPSAA
EVQAIKCFLAKCWSLDISTKEYAYLKGTVLFNPGLPGLQCMKYIQGLQWGTQQILIDHIR
MTHRRHQARITELNSVLFLLRFINANVIAELFFRPIIGSVSMDDMILEMLCAKL
Download sequence
Identical sequences M3XU81
ENSMPUP00000002631 ENSMPUP00000002631 XP_004761915.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]