SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002635 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002635
Domain Number 1 Region: 325-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000331
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002635
Domain Number - Region: 98-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0345
Family Intermediate filament protein, coiled coil region 0.0048
Further Details:      
 
Domain Number - Region: 171-239
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0484
Family PspA lactotransferrin-binding region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002635   Gene: ENSMPUG00000002664   Transcript: ENSMPUT00000002690
Sequence length 477
Comment pep:novel scaffold:MusPutFur1.0:GL896929.1:5706976:5708518:-1 gene:ENSMPUG00000002664 transcript:ENSMPUT00000002690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLLTNSVWTRSSFSAPYRTSVRFSLLASTPASTLASTMSVGGVGSFWGGLNSSRSVVRG
YGCGAEGMGSITAVSVNQSLLSPLKLEADPNIQAVRTQEKEQVKTLNKPASFPDTARHLE
QQNKIRETKRSLLQQQKTARSNPDMLESCISNLRWPWTPGPEKLKPEAEEDFRGQCKELL
REHADVENEFVLIKKDVDEAYKNKVELESCLEGLTNDIRFLRGTCEEICELQSQISDMSV
VLSMDNSCSLRLDGIITEVKAQYEDFANRSRPQAETLYQIKHEELQTLAGKHGDVLRRTK
TEISELNWSIGQLQAEIEALQNQAALEAASADAEQHGELAIKDANAKVAELEATLLQAKQ
DMAGHLCKCPELMNVELALNIKITTYRKRLEGKQSRLESGTLSTRIHTKTSSSYSCGLSS
AHGGLPNPGLNYSLSSFQANFGPAGSFSGSSSSKAVVVKKIDIVTGSWCPSHVMSCP
Download sequence
Identical sequences M3XU85
ENSMPUP00000002635 ENSMPUP00000002635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]