SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002687 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002687
Domain Number 1 Region: 94-278
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.34e-79
Family T-box 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002687   Gene: ENSMPUG00000002715   Transcript: ENSMPUT00000002742
Sequence length 559
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:7750577:7836328:-1 gene:ENSMPUG00000002715 transcript:ENSMPUT00000002742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGALCARARASPRLGGRHGPASTRRPEQDPARAQGAGHTMADADEGFGLAHTPLEPDS
KELPCDSKAESALGAPSKSPASPQAAFTQQGMEGIKVFLHERELWLKFHEVGTEMIITKA
GRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHP
DSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNT
AFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYPVVP
RSTVRQKVASNHSPFSSEPRALSASSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHGQ
IYHCTKRKDEECSTTDHPYKKPYMETSPSEEDPFYRAGYPQQQGLSASYRTESAQRQACM
YASAPPPSEPVPSLEDLSCNTWPSVPSYSSCTVATVQPMDRLPYQHFSAHFASGPLVPRL
AGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLPSPGGLQPSEFLYSHGVPRTLSP
HQYHSVHGVGMVPEWSENS
Download sequence
Identical sequences M3XUD7
ENSMPUP00000002687 ENSMPUP00000002687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]