SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002688 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002688
Domain Number 1 Region: 422-640
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-56
Family DBL homology domain (DH-domain) 0.0000457
Further Details:      
 
Domain Number 2 Region: 630-780
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-20
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 3 Region: 787-850
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000302
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002688   Gene: ENSMPUG00000002716   Transcript: ENSMPUT00000002743
Sequence length 870
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896947.1:4925345:5046313:1 gene:ENSMPUG00000002716 transcript:ENSMPUT00000002743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSESEVDFSSNSLTPLWRRRSTPQPPLVGRSKPRPQSYQSPSGLLITDFPVEDRGTLPA
MQAPTQGPTASEGRTVQGNPQLLCAHRRVVTNGRTISPEYRSVSPRLRRPNSPQAPKAVS
GVSSKSPANGTVTSPLPQPVCPQRTTKSPPCCSWEVDLTASTTSPLPSTAANGLFPEIDS
PGAGSRSGQATNDPEPELTKLSPAPQKSSSEHKLPLQRLPSQENELPENPSVVLSTNSPA
ALKVGKQQIIPKSLASEIKLSKSNSQNVEPHRRLFKVRSMVEGLGASLGPSEDEGDAEND
VDSPGSLRRGLRSTSYRRAVVSGFDFDSPTTSKKKNRMSQPVLKVVMEDKEKFSSLGRIK
KKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQL
SAVKRNGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSETMTKTESH
HLFSNITDVCEASKKFFTELEARHQSNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQR
TLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSP
KYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGE
LTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNEE
LNSSPGKNSSTMLYSRQSSANHLFTLTILSNHASEKVEMLLGAETQSERARWITALGHSS
GKQPLDRTSLTQVEIIRSFTAKQPDELSLQVADVALIYQRVSDGWYEGERLRDGERGWFP
MECAKEITCQATIDKNVERMGRLLGLETNV
Download sequence
Identical sequences M3XUD8
ENSMPUP00000002688 XP_004755646.1.14098 XP_004755647.1.14098 XP_012913187.1.14098 ENSMPUP00000002688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]