SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002731 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002731
Domain Number 1 Region: 205-534
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.61e-71
Family Pancreatic carboxypeptidases 0.000003
Further Details:      
 
Domain Number 2 Region: 26-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.11e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 534-623
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.08e-20
Family Carboxypeptidase regulatory domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002731   Gene: ENSMPUG00000002760   Transcript: ENSMPUT00000002788
Sequence length 647
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896929.1:7112664:7237337:1 gene:ENSMPUG00000002760 transcript:ENSMPUT00000002788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTKSSEKAANDDHSVPVARDDVRESCPPLGLETLKITDFQLHASTSKRYGLGAHRGRLN
IQAGINENDFYDGAWCAGRKDLRQWIEVDARRLTKFTGVITQGRNSLWLSDWVTSFKVMV
SNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRVNPQSWFDNGSICMRLE
ILGCPLPDPNNYYHRRNEMTTTDDLDFKHHSHKEMRQLMKAVNEMCPNITRIYNIGKSHQ
GLKLYAVEITDHPGEHEVGEPEFHYIAGAHGNEVLGRELTLLLMQFLCQEYLAGNARIVR
LVEETRIHILPSLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDR
QNIPRKVPNHYIAIPEWFLSENATVAVETRAVIAWMEKIPFVLGGNLQGGELVVAYPYDM
VRSLWKTQEPSPTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEDGTVNGASWHT
VAGSLNDFSYLHTNCFELSIYVGCDKFPHESELPEEWENNRESLIVFMEQVHRGIKGVVR
DSHGRGIPNVIISVEGINHDIRTASDGDYWRLLNPGEYVVTAKAEGFASSTKNCMVGYDM
GATQCDFTLSKTNLARIREIMEKFGKQPISLPARRLKLRGRKRRQRG
Download sequence
Identical sequences M3XUI1
XP_012911177.1.14098 ENSMPUP00000002731 ENSMPUP00000002731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]