SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002782 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002782
Domain Number 1 Region: 464-649
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.93e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 329-409
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000392
Family WWE domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002782
Domain Number - Region: 238-262
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00973
Family CCCH zinc finger 0.006
Further Details:      
 
Domain Number - Region: 266-320
Classification Level Classification E-value
Superfamily WWE domain 0.0373
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002782   Gene: ENSMPUG00000002811   Transcript: ENSMPUT00000002841
Sequence length 657
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896947.1:7053370:7079254:1 gene:ENSMPUG00000002811 transcript:ENSMPUT00000002841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMETTEPEPDCVVQPPSPPDGFSCQMRLSEKITPLKTCFKKKEQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSADESSLHEPIVKKPLEISPSCPPAENSMSVLIPDGTSVGGQ
IPEAHPSTDAPEQVVPIQDHSFPPETLSGTVADSTAGHFQTDLLHSVSSDVPASPDCIDK
VMDYIPGVFQDNSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVSTDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFTLLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWIYMHPSQDFIQVPVSVEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGS
HGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
Download sequence
Identical sequences M3XUN2
ENSMPUP00000002782 XP_004755676.1.14098 ENSMPUP00000002782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]