SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002786 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002786
Domain Number 1 Region: 304-721
Classification Level Classification E-value
Superfamily Nitric oxide (NO) synthase oxygenase domain 1.44e-205
Family Nitric oxide (NO) synthase oxygenase domain 0.0000000000000927
Further Details:      
 
Domain Number 2 Region: 1002-1269
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.19e-83
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.000000000252
Further Details:      
 
Domain Number 3 Region: 755-840,875-986
Classification Level Classification E-value
Superfamily Flavoproteins 2.66e-53
Family Cytochrome p450 reductase N-terminal domain-like 0.0000000164
Further Details:      
 
Domain Number 4 Region: 1271-1434
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.24e-50
Family NADPH-cytochrome p450 reductase-like 0.000000119
Further Details:      
 
Domain Number 5 Region: 13-107
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-22
Family PDZ domain 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002786   Gene: ENSMPUG00000002815   Transcript: ENSMPUT00000002845
Sequence length 1467
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:10036253:10206819:-1 gene:ENSMPUG00000002815 transcript:ENSMPUT00000002845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQVFSVQQIQPNVISVRLFKRKVGGLGFLVKERVNKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGQPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTRPLGLPTTAVDLSHQSSASKEHMPAVDGTTGPGNGPQHTQDSRQEAGSLSNTNSLAP
RPPGQDPTKKSTGGAPQDSQNSELLKEIEPVLSLLTSGSKGINGGGPSKAETKDAEVQVD
RGVDGKSHKPLPLGVENDRVFSDLWGKDHVPVILNNPYSEKEQPPASGKQSPTKNGSPSK
CPRFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQQIRRPEDVRTKEQLFP
LAKEFIDQYYSSIKRFGSKAHTERLEEVNKEIETTGTYQLKDTELIYGAKHAWRNASRCV
GRIQWSKLQVFDARDCTTAHGMFNYICNHIKYATNKGNLRSAITIFPQRTDGKHDFRVWN
SQLIRYAGYKQPDGSILGDPANVEFTEICVQQGWKPPRGRFDVLPLLLQANGNDPELFQI
PPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVR
DYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATE
SFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPEPWNTHVW
KGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEI
FKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVHE
ERKYPEPLHFFPRKGPPLPQGDPGVRGLAAARDSQQRSYKVRFNSVSSYSDSHKSSGDGP
DLRDNFESAGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCG
QEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPELTQ
GLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNRED
LVNALIERLEDAPPVNQLVKVELLEERNTALGVISNWTDEHRLPPCTIFQAFKYYLDITT
PPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPSTL
LLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYRTRDGEGPIHHGVCSSWLNRIQADE
VVPCFVRGAPSFHLPRNPQVPCILIGPGTGIAPFRSFWQQRQFDIQHKGMSPCPMVLVFG
CRQSKTDHIYREETLQAKNKGVFRELYTAYSREPDKPKKYVQDILQEQLAEPVYRALQEQ
GGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRLRDDNRYHEDIFGVTLRTY
EVTNRLRSESIAFIEESKKDTDEVFSS
Download sequence
Identical sequences M3XUN6
ENSMPUP00000002786 XP_012912028.1.14098 ENSMPUP00000002786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]