SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002793 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002793
Domain Number 1 Region: 377-595
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-52
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 905-1154
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000075
Family WD40-repeat 0.062
Further Details:      
 
Domain Number 3 Region: 628-686,779-837
Classification Level Classification E-value
Superfamily PH domain-like 0.000000784
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002793
Domain Number - Region: 275-334
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0458
Family C-terminal domain of PLC-beta 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002793   Gene: ENSMPUG00000002822   Transcript: ENSMPUT00000002852
Sequence length 1332
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897021.1:5013143:5071050:-1 gene:ENSMPUG00000002822 transcript:ENSMPUT00000002852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLGLTVSFRPVDNAAKRESADEDDEGEQFDFDSGDEVPEADRQAADAPPAGNAGADASG
SGGEVGVGTDTDAPAEPAALQAPARVNPYSVIDIAPFQDEQPLPPDADAEDDTGSQPVPS
GYSVPVPCGYAVPCSLPLLLPAYSSPVAVRAVPPHEEETQEAADDSQFTSLRSEDPASSD
DRVHKADSALARWVADPANTAWMENPEEAIYDDVPRENSDSEPEEMVYDDVENGEEGGNS
SAECGWSSSEFESYEEQSDSECRNGVPRSFLRSNHRKQLSHDLARFKEHYESKMRALMAT
AVGAAEIQQLKQRHERKMQRLMKAAREGTKDGLQKTRAAVRRGRSLIRTRSFLAADHRSC
LEEEQNLFIDVDCKHPEAVLTPMPEGLSQQQVVRRYILGSVVDSEKNYVGALKRILEQYE
KPLSEMEPKMLSERKLRLVFYRVKELLQCHGMFQIALASRVAEWDSVETIGDVFVASFSK
SMVLDAYSEYVNNFSTAVAILKKTCATKPAFLEFLKQCQESSPDRVTLYSLMTKPIQRFP
QFILLLQDMLKNTSRGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKQVAQAVNER
YLSKLLSSGNRYLVRSDDMIETVYNDRGEIVKTKERRVFLLSDVLMCATVSARTADSNAL
ASPGRKYLLKWSVPLGRVEVVEYGSSDGAGENRCPPVHPPESLAVVANAKPNQVYVGPGQ
LYQDLQNLLHDLNVVGQISQLVGSLRGNYQNLNQSVAHDWTSGLQRLILKKEEAIRAADC
CRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIKESWLNSLQMAKLALEEENHMGWFCVEDD
GNQIKKERHPLLVGHMPVTVAKQQEFKIECAAYNPEPCANSEAQLDPLAAAHGFLWIGSC
TNQMGQIAIVSFQNSTPKVIECFNVESRILCMVFVPTEERPAQPEAAARGALGVPTICLG
TEEGSISVYKSSQGSKKVRLQHFFTPDKSTVMSLACTPQSLYAGLVNGAVAVYTKAEDGS
WNSDPQEVIQLGVLPVRSLVMAEDALWAASGGLVFTIRTDTHTIENQLEAHQEEGMVVSH
MVIAGVGVWIAFTSGSTLRLFHTETLKHLQDVNIATPVHHMLPGHQRLSVTSLLVCHGLL
MVGTSLGVVVALPVPRLQGIPKVTGRGMVSYHAHNGPVKFLVMAAATVRTDKDKPTDSPP
PGAEALEEEQKEAPPGEGPGPSQSGADGIWLGGSLGSGTPRSDFSSSSGSLTASQGSGSL
EPRSEESVVYDLLRLPSVLPSRGRRARRAKASSVLVACGGQGHRRVSRKARQQRPEELAS
SVMVWQIPLLSA
Download sequence
Identical sequences M3XUP3
ENSMPUP00000002793 ENSMPUP00000002793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]