SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002802 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002802
Domain Number 1 Region: 493-518,700-806
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-22
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 2 Region: 66-304
Classification Level Classification E-value
Superfamily ARM repeat 0.000000838
Family Diap1 N-terninal region-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002802   Gene: ENSMPUG00000002831   Transcript: ENSMPUT00000002861
Sequence length 820
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896947.1:7684839:7930943:-1 gene:ENSMPUG00000002831 transcript:ENSMPUT00000002861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETYGPGPAESPLIIKLLIMHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIK
IISSSLDYQTNNNDQAVVEICITRITTAIRETESIEKHAEALVGLWDSCLEHSLRPSGKD
EDTPHAKIASDIMSCILQNYNRPPVMALAIPIAVKFLHRSNKELCRNMSNYLSLAAITKA
DLLANHTDVIVKSILQGNAMLLRVLPAVYEKQPQPINRHLTELLALMSQLEQPEQYHLLR
LLHVAVKRKQPEVAQKCIPFLIGHLKDSTHNDVILNILIEIAGYEPVALNGFLPMLKEIG
ERFPYLIGQMARLYGAVGHVDEERARSCLPFLSRDIFRMSNSFTTIARLLTQQLETAKAK
SSRKKTSTEVEIPEKLEKIKLTLAENEDHEKLQFKIQAFEDKINAESNTPSSIRRYSLGQ
FSKEERKDIRFNRSKSLALHTALTKNESSDDEEVVESEDKPTSFFLSETDPLRQGNDKLP
FKTNSDRSQLGNSSVSHSSIMHTESENLPETVKENCQEETPETTASPVEYQDKLYLHLKE
NFSKVKAYAMEIGKKIPVPDQCTIEDSVRSCVAKLFFTCSLKGHYCLYSKSSFILISQEP
QPWIQIMFLFQQSLFPEPLSIQSHSVQFLRALWEKTQAEGAHSFETAMMESTFPQQKDLD
QVQLHLEEVRFFDVFGFSEAAGAWQCFMCNNPEKATVVNQDGQPLIEGKLKEKQVRWKFI
KRWKTRYFTLAGNQLLFQKGKSKDDPDDSPIELSKVQSVKVVARKRRDRSLPRAFEIFTD
NKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL
Download sequence
Identical sequences M3XUQ2
ENSMPUP00000002802 XP_012913211.1.14098 ENSMPUP00000002802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]