SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002828 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002828
Domain Number 1 Region: 1058-1225
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000508
Further Details:      
 
Domain Number 2 Region: 499-700
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-45
Family DBL homology domain (DH-domain) 0.00052
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 1.26e-34
Family Bcr-Abl oncoprotein oligomerization domain 0.0000193
Further Details:      
 
Domain Number 4 Region: 711-782,840-876
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-16
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 918-1044
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000717
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002828   Gene: ENSMPUG00000002857   Transcript: ENSMPUT00000002887
Sequence length 1279
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:401126:519791:1 gene:ENSMPUG00000002857 transcript:ENSMPUT00000002887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFAEAWKAQFPDSEPPRMDLRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRASAQRPLPAPADGADPPPAEEPEARPDGE
GSPSKARPAAARRLGAAVAADREDRGPPTSVAALRSNFERIRKGHGQPGAADAEKPFYVN
VEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGPGPGLGDAPRPSYRGRSSESN
CGLDGDYEDAELNPHFLKDNLINANGGSRPPWPPLEYQPYQSIYVGGMMVEGEGKGPLLR
SQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPT
TYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQGQVIVSEATIVGVRKTGQIWPSDG
DSLSGRLTQDGTFHGDADTSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLGSK
GRGALASGTLESTKVSELDLEKGMEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAAT
TSQPVLTSQQIETIFFKVPELYEIHKEFYDGLSPRVQQWSHQQRVGDLFQKLASQLGVYR
AFVDNYGVAMETAEKCCQANAQFAEISENLRARSNKDAKDQTTKNSLETLLYKPVDRVTR
STLVLHDLLKHTPSSHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKD
SFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQTVDESEA
APSIPLVLDEELDAMKIKISQIKNDIQREKRANKGSKAIERLKKKLSEQESLLLLMSPSM
AFRVHNRNGKSYTFLISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTV
HSIPLTINKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRD
TTEPNWNEEFEIELEGSQTLRILCYEKCYNKTKITKEDGESTDRIMGKGQVQLDPQALQD
RDWQRTVIAMNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVR
QCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYF
RELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEK
ETVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPISMTDSWSLEVMSQVQVLLYFLQL
EAIPAPDSKRQSILFSTEV
Download sequence
Identical sequences M3XUS8
ENSMPUP00000002828 XP_004742507.1.14098 ENSMPUP00000002828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]