SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002835 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002835
Domain Number 1 Region: 300-618
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.31e-127
Family Mammalian PLC 0.0000000000414
Further Details:      
 
Domain Number 2 Region: 139-295
Classification Level Classification E-value
Superfamily EF-hand 4.85e-46
Family EF-hand modules in multidomain proteins 0.000000698
Further Details:      
 
Domain Number 3 Region: 629-754
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.74e-34
Family PLC-like (P variant) 0.00000405
Further Details:      
 
Domain Number 4 Region: 14-129
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-30
Family Pleckstrin-homology domain (PH domain) 0.000000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002835   Gene: ENSMPUG00000002864   Transcript: ENSMPUT00000002894
Sequence length 756
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:1492929:1516445:1 gene:ENSMPUG00000002864 transcript:ENSMPUT00000002894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRKGHRTEGMEKFARDVPEDRCFSVVFKDQRNTLDLIAPSPAEAQH
WVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDDEIEAFYKMLTQREEIDRTFAEAAGSRETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLMSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPVIYHGYTF
TSKILLCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTILGPMLLDRPLDG
VTTSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQRK
PREDKLRLVKELSDMVIYCKSVHFGGFSSPGTPGQAFYEMVSFSENRALRLLQESGNSLV
RHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNSTFNSRALTQGPWWTRKRLTVRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVGRDMASRQTAVVTNNGFNPWWDTEFEFEVVVPELALVRFVVEDYDTSSKNDFIGQST
IPLSSLKQGYRHVHLLSKNGDQHPSATLFVKVSLQD
Download sequence
Identical sequences M3XUT5
ENSMPUP00000002835 XP_004759418.1.14098 ENSMPUP00000002835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]