SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002866 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002866
Domain Number 1 Region: 112-308
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.27e-57
Family Prokaryotic proteases 0.000000648
Further Details:      
 
Domain Number 2 Region: 323-419
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-22
Family HtrA-like serine proteases 0.0034
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000053
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002866   Gene: ENSMPUG00000002895   Transcript: ENSMPUT00000002925
Sequence length 422
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896929.1:8275005:8332341:-1 gene:ENSMPUG00000002895 transcript:ENSMPUT00000002925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXAACGLQEGPCGEGLQCVVPFGVPASATVRRRSQAGLCVCTSSEPV
CGSDANTYANLCQLRAASRRSERLHQPPVIVLQRGACGQGPEDPNSLRHKYNFIADVVEK
IAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATY
EAKIKDVDEKADIALIKIDHEGRLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVS
TTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSD
KIKKFLTESHDRQAKGKAITKKKYIGIRMTSLTSSKAKELKDRHRDFPDVLSGAYIIEVI
PDTPAEAGGLKENDIIISINGQSVVSASDVSDVIKKENTLNMVVRRGNEDIMITVIPEEI
DP
Download sequence
Identical sequences M3XUW6
ENSMPUP00000002866 ENSMPUP00000002866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]