SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002897 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002897
Domain Number 1 Region: 1072-1107,1193-1288,1390-1636,1686-1716
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.16e-39
Family Tandem AAA-ATPase domain 0.045
Further Details:      
 
Domain Number 2 Region: 7-117
Classification Level Classification E-value
Superfamily TPR-like 7.23e-19
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 3 Region: 480-631
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000154
Family Ankyrin repeat 0.0085
Further Details:      
 
Domain Number 4 Region: 219-346
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000539
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002897   Gene: ENSMPUG00000002926   Transcript: ENSMPUT00000002956
Sequence length 2976
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:2461994:2538098:1 gene:ENSMPUG00000002926 transcript:ENSMPUT00000002956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTTYAQLLKESGNQVLKNGNFSLAIRKYDEAIQILLQLYQWGVPPRELAVLLCNKSNA
FYSLGKWNEAFVAAKECLQWDPTYVKGYYRAGYALLRLLQPYEAARMFFEGLRLLQGAPD
QIQVADFLVGVFTTMGSDPIVLQSFLPCFDHIFTTGFSTQVWQSVIEKLAKKGLWHSFLL
LSARKDRLPRNIQVPELSLKSLFEKYVFMGLYEKMEQVPKLVQWLICIGASIETIGPYPL
HALMRLCIQAKENHLFRWLMDHKPEWKGRINQKDEDGCTVLHVVAAAPYPGYLIKRQTED
VQMLLRFGADPTLLDRQSRSAMDVLKRNKNFKAIEKINSHLAKLTACSKDLSGLNNGDGP
VSETDIFRKASEQLVKYMNSGNRLLHKNFLKQEVVQRFLRLLSSLQEIPPDLVCDINRDC
ANTFIKFLLEKQKWPEVLLLLTRKVSGEPPLGDCLIKGCNFSDLDLCTVIPRLSTWDPRR
MQLLGCLIDSGALPEGLHDSQERPLVTCLKHEDFELAFLLLTKGADPRRISLTEGDTPLH
AALHIFLDIKADIGFNFLSHLLDLFWSNPTEFCYLNPNSQDSNGNTLMHIIFQKGMLKRM
KKLIDLLVKFDINFNLKNKEGKDARHRIKKNDALLLAWNKALMENKRRNRQDPAAHPGKL
PRPTAPGHTSQLKSQGSSKSLPCSIPARALPEGAMVPDSWEALPDVQVMREEPEAVRPCS
LRDRLVQDITDLIQQVELDTSLPEDCPQDSEPLQTGVGTEVKKDELQRALGAQGSDSSGN
QHSVLEAGGAHAQAGLGASQLVSAGHRGSEGRDDPDSWNTQDIEACLQDFENMTWEIECT
SEMLKKLSSKVMTKVMKKKIILAIQQLGNGEWTQGLQKRLKHLKGSIQLFEAKLDKGARM
LWELAIDFSPRCSENPEKIIAAAERNLHSPEKSGRVYTEIIRIWDIVLDHCKLSDSIRAI
CSAYNRGLSCVLRKKLKGIHQGQLSANVKIQKRIPRFYVEDTEAEKNLEHVNPEYFPPAS
AVETEYNIMKFHSFSNSMASNILNDTTATVEYPFRVGELEYAVIDLNPRPLEPIILIGRS
GTGKTTCCLYRLWKKFHSYWEKAEQAGSPLLAKQIWLKRRLEVESGKEGPRTEEVDKEEE
VEEEEEEGSMEVETVDSIDEDQDSEACAGGPSGEPGEPGQAAEVCAAEQPHQLEHLHQIF
VTKNHVLCQEVQRNFIELSKSTKATSHYKPLEPNVHKLQDLRDENFPLFVTSKQLLLLLD
ASLPKPFFLRNEDGSLKRAIVGWSTQEELTIPNWQEDEEETEADGDNGEEDKAPETRMCE
SDPRVYVTFEVFANEIWPKMIKGKTSYNPALIWKEIKSFLKGSFEALSCPQGWLTEEAYK
KLGRKRSPNFKEDRSEIYSLFCLYQQIRSQKGYFDEEDVLYNLSRRLSKLKVLPWSIHEL
YGDEIQDFTQAELTLLMKCINDPNAMFLTGDTAQSIMKGVAFRFSDLRSLFHYASRNTVD
KQCAVRKPKKIHQLYQNYRSHSGILNLASGVVDLLQFYFPESFDRLPRDSGLFDGPKPTV
LESCSVSDLAILLRGNKRKTQPIEFGAHQVILVANEMAKEKIPEELGLALVLTVYEAKGL
EFDDVLLYNFFTDSEAYKEWKIISSFTPSSSDSRQENRPLIEVPLEKPCSSQGRSLMVNP
EMYKLLNGELKQLYTAITRARVNLWIFDENPEKRAPAFKYFMGRNFVQVVKTDENKDLDD
SMFVKTSTPEEWIAQGDYYAKHQCWKVAAKCYQKGGAFEKEKLALAHNTALNMKSKKVSP
KEKQVEYLELAKTYLECKEPKLSLKCLSYAKEFQLSAQLCERLGKIRDAACFYKRSQCYK
DAFRCFEQIQEFDLALKMYCQEELFEEAAIAVEKYEEMLRAKTLPISKLSYSASQFYLEA
AAKYLSANKIKEMMAVLSKLDTEDQLVFLKSRRRLAEAADLLNREGRREEAALLMKQHGC
LLEAARLTADKDFQASCLLGAARLNVARDSDVEHTKAILREALDLCYQTNQLSGIAEAQF
LQGVILRDFQKLKDAFFKFDTLNHSAGVVEALYEAASQCEAEAEKVLALAPGGLEVLLNL
VRALKRVTNNAEKEMVKSCFEFFGISQVDAKYCQIAQNDPGPILKIIFDLDLNLREKKTK
DYFLIMTDQVKLALNKHLLGRLCQITQSLLGKTYPGVCMRFIVGLKCEDENCKDFHRPLR
RCEAKCLVQSKMHLVAISGLFLEAKKVFPKILAEELEEISYILPTDMYGLCKSFLNVLFP
KHFHQRVLSENPMACKEILKPNYKSFRSCRSALKEYIHFLFQNERARSRRESTDLWLSAM
QAFLVSSNYPEEFEKLLHQEEDNYNRELKALEAEKEERGRGRGSKMKGIEGKFGMLAPNK
DDDSTEKTHLCFIRLLENCIDQFYVYRNPEDYKRLFFRFMNVLVKRCKEPLIPSIGNTVA
LLEFQFVHCAVVLARLWKNAILCLPKSYIALLHYWEFLFSKKERELGDVFSIIQEYKPKD
VTRAIQDFRFHLSYLVKVLCGYENVNFNVLLDAFGEIDYVVSGEAERTLVLCLVMLVNAE
ELLQPYCKPLLYRHFQEIQTRLQLMSMDRPDQVPERLLKVVKRVLMAVNVKSVAEALQDL
LSERDEEYLMDCHWRWDSVHTKGSVVRGLYHEEVKLSRLLCMDSVDYFAEPECEFGQDET
DELALEDRDRLLAAILSQKQRKASIQRKLRRACLVVSLCISWRRRVSAQTECFREETREP
GAGNFKKADVDRTQCDLCGVKFTRGPDNYFSPGKAFEGEASEVVAISGAEPGDPEGRERN
SESYEQHIHLEGHQRQQVAYQKYSEFFQEKVDPAIVEGKLVVQDIEQSMWIRSHLGSKEH
SHMLQRKVQENIKKVSDTVEDLYRRKAWAGAEEVMARLVNVLIPSVRDAREWLMKTELRL
KEEGIVQEDDYENEVEDFGELRPRRRPRKCGKQRKY
Download sequence
Identical sequences M3XUZ7
XP_004759451.1.14098 ENSMPUP00000002897 ENSMPUP00000002897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]