SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002953 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002953
Domain Number 1 Region: 3108-3420
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-112
Family BEACH domain 0.000000114
Further Details:      
 
Domain Number 2 Region: 3538-3785
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.25e-34
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 3 Region: 3010-3113
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-21
Family PreBEACH PH-like domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002953
Domain Number - Region: 246-317,393-486,570-664,759-829
Classification Level Classification E-value
Superfamily ARM repeat 0.0046
Family Armadillo repeat 0.068
Further Details:      
 
Domain Number - Region: 1543-1694
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00522
Family Clostridium neurotoxins, the second last domain 0.05
Further Details:      
 
Domain Number - Region: 2333-2554,2785-2819,3177-3214
Classification Level Classification E-value
Superfamily ARM repeat 0.0806
Family Clathrin adaptor core protein 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002953   Gene: ENSMPUG00000002982   Transcript: ENSMPUT00000003013
Sequence length 3799
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897153.1:1784631:1933123:-1 gene:ENSMPUG00000002982 transcript:ENSMPUT00000003013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIDSNSLAREFLTDVNRLCNAVVQRVETREEEEETHMATLGQYLVHGRGFLLLTKLNSI
IDQALTCREELLTLLLSLLPLVWKIPVQEEKAADFNLPFSADIILTKEKNSSSQRSTQEK
LYLEGSAPSGQVSAKVNIFRKSRRQRKTTHRYSIRDARKTRLSTSDSEANSDDKSIAMNK
HRRPRLLQHFVTQSPKDDHLTAKLDHLPTKEQTPPDTMALEHSKEIIPRQESNSDILSEP
AALSIISHMNNSPFDLCHVLLSLLEKVCKFDMTLNHNSALAATVVPTLTEFLAGFGDCCN
LSDNLESQTLSTGWTEEPVALVQRMLFRTVLHLMSVDISTAETMPENLRKNLTELLRAAL
KIRTCLEKQPDPFAPRQKRTLQEVREGFAFSKYRHRALLLPELLEGVLQILICCLQSAAS
NPFFFSQAMDLVQEFIQHHGFSLFETAVLQMEWLAARDGAPAEASEHLKALINSVMKIMG
TVKKVKSEQLHHSLCTRRRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSQNPFEETVEGDV
HYPERCCCIAVCAHQCLRLLRQASLSVTCVHILSGIQTVGVCCCMDPKSVIVPLLHAFHL
PALKHVQQHILNVLNKLILDQLGGADAPQKIKQAACNICTMDPDQLVRLEEMLQGNLCEA
TPCPGLASPAYRFQGILPSSGSEDLLWKWDALEAYQKFVFEEDRLRSVQIAHHICSLMQR
GNVVVRWKLYHSVFNPVLQRGVKLAHHCQHSSVTSAQMHSCPHHDQCLPQEVLQVYLKTL
PALLKSRIIRDLFLSCNGVNQLIELNYLDGIRSHSLKAFETLIISLGEQQKDSSVPSVDG
IDVEQKDLSSLNVGTSFRNQQVCSDSPQSLSKFYASLKEAYPKKWKSFSQDVHINMINLF
LCVAFLCVSKEAESDRELANDSEDTSGYDSTTSEPLHCMPPCVSPESLVLPSPKHMHQAA
DIWSMCRWIYMLSPVFQKQFYRLGGFQACHKLIFMIIQKLFRSPGEEQGQREGDLHTHEN
QDINGTSPSEITTREDLLSSAVKRDPTVSELGGLNRTADIVGKLESQHLSSANGGRISAT
EAAPEEVEGLTSRESETSLQSIRLLEALLAICLHSTRASQQKTELEFPNQNLSVENILFE
MRDHLSRSKVTETELAKPLFDALLRVALGNHSADFEHHDAMTEKRHPSEEELSSRPGDFS
EDAEDSRCCSLKLLVEEEGYEADSESNPEDSEAGDDGVDLKPEAESFSVLSSSKDLMETF
TEGEIIYPEICMLELNLLSTGKAKLDVLAHVFESFLKIIRQKEKNIFLLMQQGTVKNLLG
GFLSILTQADSDFQACQRVLADLLVSLMSSRTCSEELTLLLRIFLEKSPCTEVLLLGILK
IIESDITMSPSQYLTFPLLHTPNLSNGVSSQKCPGILNSKALGLLRRARSSRSRKGTESG
SFPQQLLSSWHIAPVHLALLGQNCWPHLSEGFSISLWFNVECVHEAERTMEKGKKIKKRN
KSLTLRDSSLDRTENNRPEGAEYINPGERLIEEGCIHMISLGSKALMIQVWADPHSGTFI
FRMCMDSNDDTKAVLLAQVESQENIFVPSKWQHLVLTYLQQPQGKKNNHGKISIWISGQR
KPDVTLDFVLPRRTSLSSDSNKTFCMIGHCLSSQEEFLQLAGKWDLGNLLLFNGAKIDSQ
EAFYLYACGPNHTSIMPCKYGKPVNDYSKYINKEILQCEQIRELFMTKKEVDIGLLIESL
SVVYTTNCPAQYTIYEPVIRLKGQMKTQLSQRPFSSKEVQSILLEPHHLKNLRPTECKTI
QGVLHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLTKYNQQRIHELENCNGLSMI
HQVLIKQKCIVGFHVLKTLLEGCCGEDIIHVNENGEFKLDVESNAIIQDVKLLEELLLDW
KIWNKAKLGAWEMLLAALEVLIRADHHQQVFNIKQLLKAQVVHHFLLTCQVLQEHKEGHL
TSMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHPPTNTYVCHNPTNFYFSLHID
GKIFQEKVQSIMYLRHSSSGGKSVPSPEFMVISPSGFTASPPEGNNSCNIIPQRMTTNMP
RSRSLPAFPTISSRTQPQKLNGSLGRSIDKLQNIGDNYVALQEEKLSSLVSSETLKKGRE
DALVSSFESAKAACEMEAALSARTSVNSVPKGALGFPGVKVDHKELAAEPRSDDDSPGEE
SCPRRPDYLKGLASFQRSHSTIASLGLAFPSQNGSTAIGRWPSLVDRNSDEWENFTFSLG
YEPNSSQTARTHSVTEDCLVPICCGLYELLSGVLLILPDVMLQDVMDKLVQADALLVLVN
HPSPAIQQGVIKLLEAYFNRASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFIEMFF
GRRIGLDEEFDLDDVKNMDVFQKWSVIPILGLIETSLYDNMLLHSALLLLLQILNSCSKV
ADMLLDNGLLFVLCNTVAALNGLEKNVPLNEYRLLACDIQQLLIAVTIHACSSSGSQYFR
VIEDLIVLLGYLQNSKNKRTQNMAVVLQFRVLQAAMEFIRTTANHDSENLADTFQSPSAA
HQAVFPKRKSIAGPRKFPLALTDSLLMKMRSVASDELHMMMQRRLSQENPVQASETELAQ
RLQRLTILAVNRIIYQEFNPDIIDILSTPENATQSKISVSQTEISEDVHHEQPSIFNPFQ
KEILTYLIEGFKVSIGSSKTGGSKQQWPKILWSCKETFRMQLGRLLAHILSPAHSSQERK
QIFEIVREPNHQEILRDCLSPSLQHGAKLVLYLSELIHNHQDELTEEELDTAELLMNALK
LCGQKCTPPRAATKAELIKMIKEEQKKYETEEATNKATWQKTVNNNQQSLFQRLDSKSKD
ISKIAADITQAVSLSQGIERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAAWYDPLY
YPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLMDRQKSEDVVKPPLSFLFEDKTHSSFS
STVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESSSLQGELEP
ASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHSILTNNLPNL
LEYGNINALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDLND
PSVYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNSGT
VLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPE
FLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDLVF
GYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFQSAHASR
PGSKLNLEGELPAAVGLLVQFAFRETREQVKEITYPSPLSWIKGLKWGEYVGSPSAPVPV
VCFSQPHGERFGSLQALPTRAICGLSQNFCLLMTYSKEQGVRSMNSTDIQWSAILSWGYA
DNILRLKSKQSEPPINFIQSSQQYQVTSCAWVPDSCQLFTGSKCGVITAYANRFTSSTPS
EIEMESQIHLYGHTEEITSLFVCKPYSIMISVSRDGTCIIWDLNRLCYVQSLAGHKSPVT
AVSASETTGDIATVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEGVSINVI
AGGLENGIVRLWSTWDLKPVREITFPKSNKPIVSLTFSCDGHHLYTANSDGTVIAWCRKD
QQRLKQPMFYSFLSSYAAG
Download sequence
Identical sequences M3XV53
ENSMPUP00000002953 XP_004777812.1.14098 ENSMPUP00000002953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]