SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002957 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002957
Domain Number 1 Region: 250-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 2 Region: 431-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 379-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 4 Region: 316-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 5 Region: 534-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 6 Region: 957-1092
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002957
Domain Number - Region: 481-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 76-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000221
Family N-terminal domain of xrcc1 0.062
Further Details:      
 
Domain Number - Region: 846-944
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0662
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002957   Gene: ENSMPUG00000002986   Transcript: ENSMPUT00000003017
Sequence length 1174
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897108.1:1763603:1797962:-1 gene:ENSMPUG00000002986 transcript:ENSMPUT00000003017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLLLLCFVWPGLLCAQQTCSRGACYPPVGDLLIGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRLPHNYNGHRVENVVSSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQDIM
MDFKGPMPAGMLIERSSDFGNTWKVYQYLAADCTSAFPRVRQGQPQSWHDVRCQSLPQRP
SGRPDGGKVQLNIMDLASGIPATHSQKIQELGEITNLRVNFTRLAPVPQRGYYPPSAYYA
VSQLRLLGSCFCHGHADRCAPQPGASAGPSAAEQVHDVCVCQHNTAGPNCERCAPFYNDQ
PWRPADDQDPHECQRCDCNGHSETCHFDPAVFAASQGTHGGVCDNCRDHTEGKNCERCQL
HYFRNRRPGAPIQETCIPCECDPDGAVPGAPCDPGTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCSVLGSHRDMPCDEESGQCLCLPHVVGPKCDQCAPYHWKLASGRGCEP
CACDPHNSLSPQCNQFTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAGTTCRACDCDFRG
TEGPGCDKVSGRCLCRPGLTGPRCDQCQRGYCDRYPVCVACHPCFQIYDADLRSQALRLS
GVRNATAGLWPGQGLEDLGLTSWIADAKSQMEQIQAILSRPSVTEQEVSQVANTIFSIRQ
TLQGLQPDLPGEEEALSLSEDVKNLDRSFNRLLITYQSKKDQFERISGANPLGAFRVLSA
AYQRSSQADQQVSDSFQLLVQLRDSWREAERLEGQLGGGAGVSGSQLVALRLEMASLPDL
TPTINKLCGGSRQAACTPGACPGELCPQDNGTACGPHCRGALPRAGGAFRMAGQVAQQLQ
GFNAQLQQTRHMIKAAEIAASKVQSDAQHLETQVSASRSQMEEDVRRLRLLIQQVRDFLS
DSDTDAATIQEVSEAVLALWLPTDSATVLRKMNEIQAIAARLPNVDLVLSQTKQDIARAQ
RLQMKAEQARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGTSRSLRLIQERVAEVQQ
VLGPAEGLVAGMTSQLRDFRARMEELSRRARQQREQAARAQQLTEGAEQRALSAQEGFDR
LKQKYAELKDQLGRSPMLGAQGSRILSVKTEAEELFGETMEMMDRMKGEGTLLGLGLLAS
REAGPSPGLLRPGLVRAGCAEGARAVGLPQVPRD
Download sequence
Identical sequences M3XV57
ENSMPUP00000002957 ENSMPUP00000002957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]