SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003008 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003008
Domain Number 1 Region: 620-931
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-90
Family Protein kinases, catalytic subunit 0.0000000506
Further Details:      
 
Domain Number 2 Region: 216-291
Classification Level Classification E-value
Superfamily HR1 repeat 1.44e-23
Family HR1 repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 132-202
Classification Level Classification E-value
Superfamily HR1 repeat 1.96e-23
Family HR1 repeat 0.0000212
Further Details:      
 
Domain Number 4 Region: 25-103
Classification Level Classification E-value
Superfamily HR1 repeat 3.66e-20
Family HR1 repeat 0.00000861
Further Details:      
 
Domain Number 5 Region: 328-344,395-485
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000208
Family PLC-like (P variant) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003008   Gene: ENSMPUG00000003038   Transcript: ENSMPUT00000003069
Sequence length 950
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:543716:560772:-1 gene:ENSMPUG00000003038 transcript:ENSMPUT00000003069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEANPPLDQELESEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKE
GAENLRRATTDLGRSLGPVELVLRGSSRRLDLLHQQLQELHAHVVLPDPAAAARDAPQSP
GAGTQACSATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDS
KTKIDIIRMQLHRALQAGQLENQAALDEAQGSPDLGAVELRIEELRHHFRVEHAVAEGAK
NVLRLLGAAKTPDRKAVSEAQEKLMESNQKLGLLRESLERRLGELPADHPKGRLLREELL
AASSAAFSARLTEPFPPTQYSTLCKPAPLTGTLEVRVVGCKDLPETIPWNPSPPVGGPGT
PDSRTTFLSRPARGLYSRSGSLSGRSSLKVEAENTSEVSTVLKLDNTVVGQTSWKPCGPN
AWDQSFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAE
VTFRNPVIERIPRLRRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFS
PGASPGTEARCTGDISVEKLNLGADLDSLSQKSPLGPPSSPSSVSSPIPETATTPELPSE
TQETPGSALCSPLKKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIV
ARDEVESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVF
SEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRT
STFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEV
RYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFYRTLGWDTLLARRLPPPFV
PKLSGRTDVSNFDEEFTGEAPTLSPARDARPLTATEQAAFQDFDFVAGGC
Download sequence
Identical sequences M3XVA8
ENSMPUP00000003008 XP_004748284.1.14098 ENSMPUP00000003008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]