SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003086 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000003086
Domain Number - Region: 32-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00408
Family PadR-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003086   Gene: ENSMPUG00000003117   Transcript: ENSMPUT00000003149
Sequence length 175
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:1336501:1342848:-1 gene:ENSMPUG00000003117 transcript:ENSMPUT00000003149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASFQMLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRG
YVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKVCIGLEGER
PARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQPEK
Download sequence
Identical sequences M3XVI6
ENSMPUP00000003086 ENSMPUP00000003086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]