SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003128 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003128
Domain Number 1 Region: 31-261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-88
Family Calponin-homology domain, CH-domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 279-400
Classification Level Classification E-value
Superfamily Spectrin repeat 1.63e-32
Family Spectrin repeat 0.000000775
Further Details:      
 
Domain Number 3 Region: 515-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-31
Family Spectrin repeat 0.00000436
Further Details:      
 
Domain Number 4 Region: 403-510
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-23
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 744-876
Classification Level Classification E-value
Superfamily EF-hand 2.66e-20
Family EF-hand modules in multidomain proteins 0.061
Further Details:      
 
Domain Number 6 Region: 640-751
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-20
Family Spectrin repeat 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003128   Gene: ENSMPUG00000003161   Transcript: ENSMPUT00000003193
Sequence length 904
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:4201154:4214575:1 gene:ENSMPUG00000003161 transcript:ENSMPUT00000003193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQPEGLGVGEGPFVGGSGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKA
GTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLV
SIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQN
FHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPVGNLNTAFEVAEKYLDIPRMLDAEDIV
NTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLE
WIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRLS
HRPAFMPSEGKLVSDIANAWRGLEQAEKGYEDWLLSEIRRVQRLQHLAEKFQQKASSHEA
WTRGKEDLLSQRDYESASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYHE
AASVNSRCQAICDQWDTLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGA
VEDLQDVWLVHSVEETQSLMSAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRPST
TNPYISLTPQDINTKWDMVRKLVPSRDQTLQEELARQQLNERLRRQFAAQANAIGPWIQG
KVEEVGRLATGMVGSLEDQMAALRQQEQNIINYKSNIDRLEGDHQLLQESLVFDNKHTVY
SMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMMEP
DDFRACLISMGYDLRNSTTGEVEFARIMTMVDPNATGVVTFQAFIDFMTRETAETDTAEQ
VVASFKILAGDKNYITPEELRRELPAEQAEYCIRRMTPYKGSGAPAGALDYVAFSSALYG
ESDL
Download sequence
Identical sequences M3XVM8
ENSMPUP00000003128 ENSMPUP00000003128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]