SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003152 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000003152
Domain Number - Region: 846-980
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00108
Family Pentapeptide repeats 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003152   Gene: ENSMPUG00000003185   Transcript: ENSMPUT00000003217
Sequence length 1253
Comment pep:novel scaffold:MusPutFur1.0:GL897390.1:34587:43061:1 gene:ENSMPUG00000003185 transcript:ENSMPUT00000003217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INRRNDCGYRMLPFQGPMLPSGILERHFPLDTQTETTEEDSVLLMPTLLAATKDPLAMGP
PVANWPKKSKTKKAPIKSITKAIPAAPTVSSANEIATNKLKVTLQALNLPIIPQINQASV
TTKTNTQASSVTAQPKKANKTRRVTAKVAQASQYPTRKEGVTTQTKSSLAIQAPLTSGSA
NSQALIVPTKPKKVSKAKKAANKAITSAVDIPLAPTTTHTTTTQGQINNEAATTHATTTC
IRLIASKAKKPTVKGINTDTELLEAPNAERPSRQTKASIVARPPKFKGKKAANIDPNSAC
EVSEAPLAQMITNQALAAALQVKRGSRVHKSVTKTQAAENQMKIVDQGLQAKIATFRTNM
SAIETQVAAAVQALADDYLAQLSLEPTTSTWGKRKQKVRSLTSPSLKFSLLFHSYLPRDW
RLLPPRDVAILQKRANKLVKYLLVKDQTKIPIKRSDMLKDVIQEYDEYFPEIIERASYAL
EKMFRVILKEIDKQSRLYILISTQESSAGILGTEARTSGAYLTKNHLASSFIGTAACSRE
VSSMFRNVSSLIWVRHSLFGEVRKLITDKFVKQKYLEYKRVPNSKPPEYEFFWGLRSYHE
TSKMKVLKFAFKIEPQSPLYAKDWAAQCQEAVEMEVQAAAVAVAETEARAEARAQMGIGE
EAVAGPWNWDDMDIDCLTREELGDDAQSWNRFSFEIETRAQENAEASTNIDFSRGVSTRA
TFSDSACISFNGVPSPSGGFGGRAGTSFGGTPRTSASFSSTASICFSGIPSTSTSFSGAA
SISFSGAASTSSSFNSEACISFGGTPCTSAGFGGGVSSSFSIPLSSSPGFSGGASSGFGG
TLSTTAGFSGALITSSSFGSLPRTSTVFSGALSTSTGFGGTLSTSVCFGGSPSSGASFGG
TLNTSICFGSSPSTTNGFDGVLSTSVSFGGSSSTSADFGGTLSTSICFGGSPSTGASFGG
AFSTSVGFGGALNTSAGFNSTSAISTSASFSSTPSTISGFGSVFSTSADFSGALTTTTDF
GITPSTNIGFGGVPSTSLCFGSVSNANLCFGGPPSTSACFSGPTTASFGDGSSTTAGFIF
GSGLNSSAGFSGGLSTSAGFSSGLGTSAIFGSGLSTSAGFGGGLISSDGFGDGLGTNAGF
SSTLGTSAGFSGGLSISDGFGAGFNNSFNGGPSTIIGFGSGSNTSTGFIGEPCTSTSFNG
GPSSIIGFSSGPSTGAGFSSGPSSGAGFGGGPRNGAGFGGGATSLGACSFSYG
Download sequence
Identical sequences M3XVQ2
ENSMPUP00000003152 ENSMPUP00000003152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]