SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003155 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003155
Domain Number 1 Region: 731-1006
Classification Level Classification E-value
Superfamily RNI-like 8.63e-61
Family 28-residue LRR 0.0035
Further Details:      
 
Domain Number 2 Region: 7-83
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000612
Family Caspase recruitment domain, CARD 0.0057
Further Details:      
 
Domain Number 3 Region: 105-184
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000565
Family Caspase recruitment domain, CARD 0.0049
Further Details:      
 
Domain Number 4 Region: 267-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000557
Family G proteins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003155   Gene: ENSMPUG00000003188   Transcript: ENSMPUT00000003220
Sequence length 1013
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:4356213:4390255:1 gene:ENSMPUG00000003188 transcript:ENSMPUT00000003220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTQEAFQAQRGQLVGLLVSGSLEGFESILDWLLSWEVLSWEDYEGLSLLGQPLSHLARR
LLDTVWNKGTWGCEQLIAAIQEAQTDYQARELSSCWDPHSPHPARDLQSHRPAIVRRLHG
HVEGVLDLAWEHGFISQYECDEIRLPIFTSSQRARRLLDLATVKANGLAAFLLRHVQKLP
VSLALPFEDAACKKYMSKLRTTISAQSRFLSTYDGAENLCLEEIYTENVLEIRTERGPAG
LPQKSPVTLGLEELFGTRGHLNEEADTVLVVGEAGSGKSTLLQQMQLLWASGRDFQEFLF
VFPFSCRQLQCVAKPLSVQTLLFEHCCWPDLGQQEVFQFLLDHPNRVLLTFDGFDEFKFR
FSDRERHCSPTDPTSVENLLFNLLQGNLLKNARKVLTSRPDAVSALLRKYLRLELHLKGF
SEEGIELYLRKCHREPGVADRLVRLLKATSPLHGLCHLPVVSWMVSKCHQELLLHGGGSP
KTTTDLYLLILQHFLLHASPPDSVPCGLAPGLLQGRLPSLLHLGRLAVWGLGTCCYVFSD
KQLQAAHIDSEDISLGFLVHAKSVVQGGTAPLEFLHITFQCFFAALYLVLSADLSPSLLR
QLFSCHGPHSSLLARLLPPMCVPRSEHQEGSTAALLQEAEPHNLQITAAFLAGLLSREHQ
GLLAGSQVSEKALLQRQACARSCLSRSLHKHFHSIPPAVPGEAKSMHAMPGFIWLIRSLY
EMQEERLAREAVRGLKVGHLKLTFCGVGPAECAALAFVLRHLRHPVALQLDHNSVGDVGV
EQLLPCLNVCKALYLRDNNISDRGVCKLVERALHCEQLQKLALFNNKLTDGCAPSMARLL
SCKRNFLALRLGNNHITATGAQVLAEGLRANASLEFLGLWGNKVGDEGAQALAEALGDHQ
SLRWLSLVGNNIGSTGAQALALMLEKNVALEELCLEENRLQDEGVCSLAEGLEKNSSLKI
LKLSDNSITYFGAEALLRALERNDTILEVWLRGNTFSAEEVERLGQRDTRLLL
Download sequence
Identical sequences M3XVQ5
ENSMPUP00000003155 ENSMPUP00000003155 XP_004744216.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]