SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003173 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003173
Domain Number 1 Region: 113-255
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-25
Family Calponin-homology domain, CH-domain 0.00088
Further Details:      
 
Domain Number 2 Region: 1234-1332
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000028
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003173   Gene: ENSMPUG00000003206   Transcript: ENSMPUT00000003238
Sequence length 1877
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896942.1:457712:665928:1 gene:ENSMPUG00000003206 transcript:ENSMPUT00000003238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSPPLPPLAERPGWSGRYVPAHPPGGGVERGRPRVGGNGRHTLRPLPSPATRRARAAA
RGGELGAGKATHLAAGPRAAGQRAPRSRARRAQAAVLERMEEAGIDCAVAFAEAQRWVEA
VTEKNFETKDFRASLENGVLLCDLVNKLKPGVIKKINRLSTPIAGLDNINVFLKACEQIG
LKEAQLFHPGDLQDLSNRVTVRQEETDRRVKNVLITLYWLGRKAQSNPYYNGPYLNLKAF
ENLLGQALTKALEDSSCLKRSGRDSGYGDIWCAERGEFPTSPGNHKREDSFESLDSLGSR
SFTSCSSDITLRGGREGCESDTDSEFTSKMQDYNKDDMSYRRISAIEPKSALPFNRFLPN
KSRQPSYVPAPLRKKKPDKNEDNRRSWASPVYPEADGTFPSGHADSPLISHQISRAEWDL
SNATCCQKEVYGSESGSDSEDERRLPDIVLDDLANRRFRVKKRPECFTSKTTSPSSYSPR
FPPADTLAPGPYALMSNERRTWGRNVENWPRAQEASRSSCYLEVEEAKTSLPNTIKDDLY
VRKLSPVIPNPGNAFDQFLPKCWIPEDVNWKRIKRETYRPWYKEFQGFSRRNSDSEDEDL
GSDRSSSIFSRIQKAKHRLDSSCQRRSLLLELATKGARNSRDTHAARRSSSAAEEPSQFL
LLQALQTYSDDILSSETNIKIDPTAGPRLITRRKNLSSAPGYKRDDLEMSTLDPDLENDD
FFVRKTGAFHANPYVLRAFEDFRRFSEQDDPVERDIILQCREGELVLPDLEKDDMIVRRI
PAQKKEVPLSGAPDRYQPVPFPEPWTLPPEIQAKFLCVLERTRPPKEKRKSCRVLVPSYR
LKKDDMLTRKIQSWQLGTTVPPVSFTPGPCSEADLQKWEAIREASRLRHRKRLMVERLFQ
KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTS
DLQKKKEEREEIEKQALEKSERSSKTFKEMLQDRESRNQTSTVTLRRRLHSFDDILHEEM
LSPTRTMSEASYQSERVEEEGTAYSTEIPKQDATTCAKREDAAAADVHLPSKSPIEEQRP
DSFSSQPSLTTQRESTRVSASLPRSYQKTDTARLTSVVTARPFGSQARGISSLPRSYTMD
DSWKYNGHVEDAKRTQNSLVSTSVQRPDLSQLVSSKSSERERAEVGEGVMGLPSPTPSYS
SLSQDQADTSRATLSSTSGPDLTSEFGEGGSSPQMEDSRSQDQFSDMRISINQTPGSGLD
FGFTVKWALSGIFVASVEAGSPAEFSQLQVDDEIIAINNTKFSYKDTKEWEATMANAKET
GNLVMDIRRHGKSGSPETKWIDTTSGIYNSDKSSSLSITTDFSESLQHSNTESKEMNGIR
DESTTFESKASESISLKNLKRRSQFFEQGSSDSVVPDLPVPTLSAPSRWVWDQEEERKRQ
ERWQKEQDRLLQEKYQREQEKLREEWQRAKQEAERENYKYLNEERMVLSSNSMSLPTREP
SAAAWDASWGEGSKSSDQEGSRAGDEETREPPKDDAEEDQRKKLQERLALEEERQLREQQ
CQQEQEQRRREAAQEHARPAEIERETSVKIYQYRRPVDSYDIPKREEKSSGLLPSDRNKS
RSTTELDDYPTNKNGGNKYLDQIGSTSSSQRSSKKEQGPSEAELERQQILQEMRKRTSLL
NDSSWIRQRSSSVNKEPICLPGIMRRGESLDNLDSPRSNSWKPSPWLNQSSGVRASSSVQ
DFSRPPPQLVSTSNRAYMRNPSSSIPPPSVGSVKTTTSPSPTPRSHSPSTSQPSSQLRNR
SVSGKRVCSYCNNILGKGAAMIIESLGLCYHLHCFKCVACSCDLGGSSSGAEVRIRNHQL
YCNDCYLRFKSGRPTAM
Download sequence
Identical sequences M3XVS3
ENSMPUP00000003173 ENSMPUP00000003173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]