SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003182 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003182
Domain Number 1 Region: 608-916
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.75e-115
Family PDEase 0.0000000788
Further Details:      
 
Domain Number 2 Region: 199-398
Classification Level Classification E-value
Superfamily GAF domain-like 1.37e-46
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 382-584
Classification Level Classification E-value
Superfamily GAF domain-like 1.18e-41
Family GAF domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003182   Gene: ENSMPUG00000003215   Transcript: ENSMPUT00000003247
Sequence length 934
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897039.1:5536580:5924126:1 gene:ENSMPUG00000003215 transcript:ENSMPUT00000003247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASHLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHRESQGAVGTRPTVAGTSS
VAHSGGAGSGRVGGGTGPNSSANSQLAPGGGDCGGVPLSPSWASGSRGDGSLQRRASQKE
LRKSFARSKAINVNRTYDEQVTARAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAMDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESVEKSSYSDWLVNNSVAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKAFD
DADQRLFEAFVIFCGLGINNTIMYNQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANV
PLVSELAINDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGDYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERAELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAA
NRRKWEELHQKRLLASAASPSSSSLMLAAEEDRN
Download sequence
Identical sequences M3XVT2
XP_004769050.1.14098 ENSMPUP00000003182 ENSMPUP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]