SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003212 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003212
Domain Number 1 Region: 837-998
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-44
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 
Domain Number 2 Region: 2-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.45e-20
Family Ankyrin repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 626-694
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.26e-16
Family SAM (sterile alpha motif) domain 0.0029
Further Details:      
 
Domain Number 4 Region: 700-770
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000628
Family SAM (sterile alpha motif) domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003212   Gene: ENSMPUG00000003245   Transcript: ENSMPUT00000003277
Sequence length 1105
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:1780165:1883097:1 gene:ENSMPUG00000003245 transcript:ENSMPUT00000003277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDVVEVLLRNDALTNVADSKGCYPLHLAAWKGDAQIVRLLIHQGPSHTRVNEQNALEIKE
FKKYGPFDPYINAKNKSAYTSLKCRSSVAMVELLKSFICSLLKEPQRFAFCPELPLPSNL
LAGKNDAVKCQIKSRWNCMHVWTPSHCLYSICRVEPSQTWVTVLMTCCSALSFAFQTEKG
SALHEAALFGKTDVVQILLAAGIDVNIKDNRGLTALDTVRELPSQKSQQIAALIEDHMTG
KRGAKEADRTPTSQGPLISSMVSVSQESQGDMEKAVTELIIDFDTNAEEEGPYEALYNAV
SCHSLDSMASGRSSDRDSMNKEAEAAGVKTAGVRPRERPPPPAKPPPDEEEEDHIDKKYF
PLTASEVLAVRPWIQGSTAQEEEEHPYELLLTAETKKLGSTDGDVQDHRRSSSSRSQDSA
EGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLSAPGQSHPEGSPAQGACHEASMQLEETG
VHAPGASNRVERLGSHSGLNTRAARKYLCICKHFSPVRYLSLEKIELKKDVSQKPPTYRA
CREVEIGRIINKRRSNSLTCLPSPTVYLLGKKISDPRKSYVLNISLPKSRLDVPTFSSVW
NQIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVGEWLEAIGLQQYESRLLLNGFDDVRFL
GSNVMEEQDLREIGISDPQHRRKLLQAARSLPKVKALGCDGSSPPSVPSWLDSLGLQDYV
HSFLSSGYSSIDTVKNLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLR
CQDLLSQTSSPLSQNDSCTGRSADLLLPPGDTGRRRHDSLHDPAAPSRAERFRIQEEQRE
AKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGTESTQDACAKM
RKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNISCAAQDPEDLCTFAYITKD
LQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRSLGPSTADMIETKSSK
PVPKPRVGTRKSAVPPPPDSRCCHCHTCTTHRPSYLPLPSVSPGVKLEPPDTDPDAQSHA
SVSWVVDPKPDSKRSLSTKYETTIF
Download sequence
Identical sequences M3XVW2
ENSMPUP00000003212 ENSMPUP00000003212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]