SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003213 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003213
Domain Number 1 Region: 254-415
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-45
Family Phosphotyrosine-binding domain (PTB) 0.003
Further Details:      
 
Domain Number 2 Region: 43-111
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.52e-17
Family SAM (sterile alpha motif) domain 0.0029
Further Details:      
 
Domain Number 3 Region: 117-188
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000196
Family SAM (sterile alpha motif) domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003213   Gene: ENSMPUG00000003245   Transcript: ENSMPUT00000003278
Sequence length 516
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:1853938:1887629:1 gene:ENSMPUG00000003245 transcript:ENSMPUT00000003278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNPSLTASPFCPSFLSFQIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVGEWLEAIGLQ
QYESRLLLNGFDDVRFLGSNVMEEQDLREIGISDPQHRRKLLQAARSLPKVKALGCDGSS
PPSVPSWLDSLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVHLLGHRKRIIASLAD
RPYEEPPQKPPRFSQLRCQDLLSQTSSPLSQNDSCTGRSADLLLPPGDTGRRRHDSLHDP
AAPSRAERFRIQEEQREAKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSML
IKDLRGTESTQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNISC
AAQDPEDLCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKS
RSLGPSTADMIETKSSKPVPKPRVGTRKSAVPPPPDSRCCHCHTCTTHRPSYLPLPSVSP
GVKLEPPDTDPDAQSHASVSWVVDPKPDSKRSLSTN
Download sequence
Identical sequences M3XVW3
ENSMPUP00000003213 XP_012900246.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]