SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003223 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003223
Domain Number 1 Region: 647-775
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000374
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003223   Gene: ENSMPUG00000003255   Transcript: ENSMPUT00000003288
Sequence length 951
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:918157:932911:-1 gene:ENSMPUG00000003255 transcript:ENSMPUT00000003288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGVNDEELEAEFLALVGGQPQVLE
KLKGKGPLPMEAIEKMASLCMRDPDEGEDEGTDEEDVEADDDLLAELNEVLGEEQKTVES
HPPATQPKATAPSPGVEATLQERLALYQTAIESARRAGDGAKMRRYDRGLKTLENLLASV
RKGNTIDEGDIPPPVAVGKGPAATPCHTPTPTQPSSAHQPVPEPRVTVEGLPASAPTTSI
SLTKPQLPPGPCSPGPLAQLQSRQREYKLAALHAKQQGDTVTAARHFRVAKSFDAVLEAL
SRGEPVDLSRLPPPPDQLPPDPPSPSPQPPTPTTVPSTPEVPPPPRTLLEALEQRMERYH
VAAAQAKAKGDQRKARMHERIVKQYQDAIRAHKAGRAVDVAELPVPPGFPPIQGLEATEP
TQQSLVGVLETAMKLANQDEGQEDEEDEEPRKPTSPPTPAAQPKAPPSRATPSGSTPAAK
TAPKGTSTRAQQQLAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNG
LPVDIAKVPPAPVNKDDFSLVQRPGPGLSQDSARRYGELTKLIRQQHEMCLNHSNQFTHL
GNIAETSKFEKLAEDCKRSMEILKQAFARGLPTPTARFEQRTFSVIKIFPDLSSNDMLLF
IVKGINLPTPPGLSPSDLDVFVRFDFPYPNVEEAQKDKTSVVKNTDSPEFKEQFKLCINR
SHRGFRRAIQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDALETACEVREILEVLDGRRPT
GGRLEVMVRIREPLTAQQLETTTERWLVVDPVPAAVPTQVAGPKGKAPPVPAPAREPGNR
SARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIVQRSQWQRAQLEQGGPG
IRREYAAQLERQLQFYTEAARRLGNDGSREAAKEALYRRNLVESELQRLHR
Download sequence
Identical sequences M3XVX3
ENSMPUP00000003223 XP_004748327.1.14098 ENSMPUP00000003223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]