SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003241 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003241
Domain Number 1 Region: 115-232
Classification Level Classification E-value
Superfamily PX domain 1.7e-32
Family PX domain 0.00047
Further Details:      
 
Domain Number 2 Region: 281-455
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000523
Family BAR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003241   Gene: ENSMPUG00000003273   Transcript: ENSMPUT00000003306
Sequence length 474
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896933.1:487395:584669:-1 gene:ENSMPUG00000003273 transcript:ENSMPUT00000003306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLGGAGLAAAAGRARTVGMEGDRLASQARSSGLPAGGATGESPGVDAPLLGGSGSSAL
LQAQVLDLDEDEDDLEVFSKDASLMDMNSFSPMMPTSPLSMINQVKFEDEPDLKDLFITV
DEPESHVTTIETFITYRIITKTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPL
PEKFIVKGMVERFNDDFIETRRKALQKFLNRIADHPTLTFNEDFKVFLTAQAWELSSHKK
QGPGLLSRMGQTVRAVALSMRGVKSRPEEFMEMNNFIEIFSQKINLIDKISQRIYKEERE
YSDEMREYGPIHLLWSASEEDLADTLKGVASCIDKCCKATEKRMSGLSEALLPVVHEYVL
YSEMLMGVMKRRDQIQAELDSKVEALMYKKADADLLTEEIGKLEDKVECANNALKADWER
WKHNMQNDIKSAFTETAEENIHYYEQCLATWESFLASQTDLHMEETSEDKPEAH
Download sequence
Identical sequences M3XVZ1
ENSMPUP00000003241 XP_004752595.1.14098 ENSMPUP00000003241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]