SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003251 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003251
Domain Number 1 Region: 65-142
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000005
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003251   Gene: ENSMPUG00000003283   Transcript: ENSMPUT00000003316
Sequence length 478
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897046.1:157060:203323:-1 gene:ENSMPUG00000003283 transcript:ENSMPUT00000003316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARSRHRPRLHSSSPPRAPPPPLEALHSREARRARDSDGDSDADSEVGQGIPTRTAEAV
EEEMALPNHLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPL
EIKILGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSAEWLCNGEPSH
DCDGPITDLNSDQYQYMNGKSKHSIRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERV
PDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMG
TVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYM
FSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITT
RLFLYYHTLANTRAYQQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG
Download sequence
Identical sequences M3XW01
ENSMPUP00000003251 ENSMPUP00000003251 XP_004769406.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]