SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003256 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003256
Domain Number 1 Region: 15-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-28
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003256   Gene: ENSMPUG00000003288   Transcript: ENSMPUT00000003321
Sequence length 331
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896929.1:11939319:11946841:1 gene:ENSMPUG00000003288 transcript:ENSMPUT00000003321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVW
KEEASFELPGLLMQGNPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
RLESKQGKRAKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTF
SDTSSAIIPSSHIPDASTEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLTGTHISSEK
LKSGTIGQTHLLGRQIDAFGAVPESGSLKSPHRRTLSFDTSKMNQPDSSVDEGESSFGRQ
NDPFTNVTASLPQKFATLPRKKNPFEESSES
Download sequence
Identical sequences M3XW06
ENSMPUP00000003256 ENSMPUP00000003256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]