SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003273 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003273
Domain Number 1 Region: 362-446
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000578
Family PDZ domain 0.023
Further Details:      
 
Domain Number 2 Region: 836-885
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003273   Gene: ENSMPUG00000003305   Transcript: ENSMPUT00000003338
Sequence length 1152
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896929.1:12527124:12603018:1 gene:ENSMPUG00000003305 transcript:ENSMPUT00000003338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLELSFSVLSTFLVSLGQFLLLVIYSPHPRTAQQARHGVGWPNFDKPASGKPLPAHLSG
VRVEEPHCSRAQAGGRAVPPPPPPAPPTRETCYFLNATILFLFRELRDTALARRWVTKKI
KVEFEELLQTKTAGRLLEGLSLRDVFLGETVPFIKTIRLLRPVVPSASGESDGPEGETLP
ATSPEELAFEAEVEYNGGFHLAIDVDLVFGKSAYLFVKLSRVVGRLRFVLTRVPFTHWFF
SFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIKRKHTLPSYKIRFKPFFPFQTSPG
FEEDEEEQIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANIHCTLELSSGVWEEKQRS
SIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAALADLQRGDRLIAIGGV
KITSTLQVLKLIKQAGDRVLVYYERPVGHSSQGAALQDTFGQLEENFLSSSCQPNYEEET
TGLAVDAENRDLDSEFEDLASDVRAQNELKDEAPSVSHSPKRTPTTLSVKPLGTISPVLN
RKLIVGSHPPPPKPPCKEGNKPLALKASEITDPTQVSKPTQGSTFKPPVPPRPQVKVPLP
SADTPNQTEPEVLPEKPEKVLPPPPADKPAEKQAKIMDHPEDVAPSKPFLAKQEVTRDFT
SESSCPPKDSSDDPQTWESSEIPYRNKLGKWTRTRATCFFDIEACHRYLNVALWCRDPFK
LGGLICLGHVSLKLEEVALGCLATSNMEYFSKFRLEAPSPKAMVTRTALRNLSMQKGFND
KFCFGDITIHFKYLKEGEPDHPIVTNSEKEKELHLVEEVSALPKEEQLVGQMGLTENKHS
FQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETPLCGATDRRIDRTL
KNLRLEGQETFLGLPPRIDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTD
LVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNNTGIKLVRKEGGLDDSVFIAVKEIGRD
LYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKEATESRKKSLLSAALSKSGE
RLQALTLLMIHYRAGIEDLESLESLSLDQHSKKISKYTDDTEEDLDNEITQLIDSQPFSS
ISEDLFGPSESV
Download sequence
Identical sequences M3XW23
ENSMPUP00000003273 ENSMPUP00000003273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]