SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003302 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003302
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-40
Family Second domain of FERM 0.000000602
Further Details:      
 
Domain Number 3 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 3.4e-33
Family Moesin tail domain 0.0000208
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.00000611
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003302
Domain Number - Region: 434-477
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00863
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003302   Gene: ENSMPUG00000003334   Transcript: ENSMPUT00000003367
Sequence length 604
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:9534:81692:-1 gene:ENSMPUG00000003334 transcript:ENSMPUT00000003367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEMHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTVK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVVP
PTENEHDEHDENNAEASAELSNDGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQMRSCQSS
IKQM
Download sequence
Identical sequences M3XW52
XP_012910262.1.14098 ENSMPUP00000003302 ENSMPUP00000003302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]