SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003306 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003306
Domain Number 1 Region: 664-804
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.17e-47
Family PLC-like (P variant) 0.000000175
Further Details:      
 
Domain Number 2 Region: 851-986
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-41
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003306   Gene: ENSMPUG00000003338   Transcript: ENSMPUT00000003371
Sequence length 1346
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:6848565:6942196:-1 gene:ENSMPUG00000003338 transcript:ENSMPUT00000003371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFPCSSPPGAQHAVGAIATVASRGERVATCTDHLYPRTKLSYCGASLKNRNCKDARINW
TACMLRQAMSRPTDETAGDLPVKDIGLNLSGMGGLQETSTTRTMRSRQAVSRISREELED
RFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMM
EQLQEKVHELERQNEVLKNRLISAKQQLQIQGHRQTPYNYVQSRVNTGRRKAHENAGLQA
CPRKGIRFQDVDVAETLQPMLTKYGNNLLEEAKGEIRNLENVIQSQRGQIEELEHLAEIL
KTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSVMEGKFIQL
QEKQRSLRISHDALMANGDELNRQLKEQRLKCCSLEKQLHSMTFSEKRVEELQDRINDLE
KERELLKENYDKLYNSAFSAAHEEQWKLKEQQLKVQIAQLETALKSDLTDKTEILDRFKT
ERDQNEKLSQENRELQLQYLEQKQQLDDLKHRLKFYNQESDINAEELSEALLLIKAQKSQ
KNGDLSFLEKVDNKINKDLERSMRELQATHAETVQELEKTRNMLIMQHKINKDYQMEVEA
VTQKMENLQQDYELKVEQYVHLLDSRAARIQKLEAQLKDIAYGTKQYKFKPEITPDDSID
EFDETLHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPIVQGLH
PEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTDYETIAAGQLRFHEILEKSGRIFC
TASLVGTKGDIPNFGTVEYWFRLRIPMDQAIRLYRERAKALGYITSNYKGPEQMQWSSQP
APKTSQPSSTDSTDGNLNELHITVRCCSHLKSRANHLQPHPYVVYKFFDFADHDTAIIPS
SNDPQFDDHMCFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYIGKVNVPLISLAHDRC
ISGIFELTDHKKHPAGTIHVILKWKFAYLPPSGSITTKDLGNFIRKEESEVDQRVPSTSS
VSPLVVAPTPKPRQRLTPVDKKVSFVDITPQQSSEITTPPEDVKEVSSEVEHTPEIETDM
PTLSHGPEVSQESGGAKVKEKIQQGKDDDVSFLSEGQLADRSWTSSEDETEITEELEPED
EEERSASDSDECIIPGPISKNIKQPSEKIQIEIIALSLNDSRVTADDTIQRLFVECRFYS
LPAEETPVSLPKPKSEQWVYYNYSNVIYVDKENNQAKRDILKAILLKQELPYRSVRFTVV
SDPPEDEQDLECEDIGIANIDLADMFQEGRDIIEQNIDVFDARGGGGPIGKLRVTIKALH
ALRSVYEQHRDDLEAERSRSRGTSCS
Download sequence
Identical sequences M3XW56
ENSMPUP00000003306 ENSMPUP00000003306 XP_004744248.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]