SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003395 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003395
Domain Number 1 Region: 473-534
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000226
Family LIM domain 0.0026
Further Details:      
 
Domain Number 2 Region: 531-601
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000435
Family LIM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 445-471
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000199
Family LIM domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003395   Gene: ENSMPUG00000003425   Transcript: ENSMPUT00000003461
Sequence length 641
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:6946210:7420679:1 gene:ENSMPUG00000003425 transcript:ENSMPUT00000003461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTWVSNFHPVPAGLHLPCLRFQIPTMSHPSWLPPKSTGEPLGHVPARMETTHSFGTPSI
SVSTQQPPKKFAPVVAPKPKYNPYKHPGGEGDFLPPPPPPLDDPGALPSSPGNFPPPPPL
DEGAFRAQQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQGSTSSTASPP
VSTPVTGHKRMVIPNQPPLTATKKSTLKPQPAPQAGPISVAPIGTLKPQPPPVPASYTTA
STPSRPTFNVQVKSAQPSSLYMAAPSSGQFYSQGPGPQGYNTPPVSISGQCPPPSTRGGM
DYAYIPPPGLQPEPGYGYAPNQGRYYEAYCPAGPGYGGKNDTDPAYGQQGHPNTWKREQG
YTPSGTGNQNPPGMYPVSGPKKTYITDPVSAPCAPPLQQKGGQTGSMGPPAVPPSFRPED
ELEHLTKKMLYDMENPPADEYFGRCARCGENVVGEGTGCTAMDQVFHVDCFTCIICSNKL
RGQPFYAVEKKAYCEPCYINTLEQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDG
IPFTVDAGGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHCYRCED
CGGLLSEGDNQGCYPLDGHILCKTCNSARIRVLTAKASTDL
Download sequence
Identical sequences M3XWE5
ENSMPUP00000003395 ENSMPUP00000003395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]