SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003407 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003407
Domain Number 1 Region: 71-262
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.66e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 450-515
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.43e-20
Family SAM (sterile alpha motif) domain 0.0000187
Further Details:      
 
Domain Number 3 Region: 298-338
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000366
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003407   Gene: ENSMPUG00000003438   Transcript: ENSMPUT00000003474
Sequence length 586
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:8222166:8323593:1 gene:ENSMPUG00000003438 transcript:ENSMPUT00000003474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLENNAQTQFSEPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSS
TFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIK
VMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQ
YVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQV
LGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNGDGTKRPFRQNTHGIQMTSIKKRR
SPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSMQ
SQSTYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAG
DMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSLVSFLARLGCSSCLDYFTTQGLTTIY
QIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHDFSSPPHLLRTPSGASTVSVGSSETR
GERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences M3XWF7
ENSMPUP00000003407 ENSMPUP00000003407 XP_004745309.1.14098 XP_019650299.1.58354 XP_861368.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]