SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003474 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000003474
Domain Number - Region: 1559-1586
Classification Level Classification E-value
Superfamily SIS domain 0.063
Family Phosphoglucose isomerase, PGI 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003474   Gene: ENSMPUG00000003504   Transcript: ENSMPUT00000003541
Sequence length 6658
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896958.1:1569826:1633798:1 gene:ENSMPUG00000003504 transcript:ENSMPUT00000003541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELYLSACSKAANVAASKTATSSLATDSQQCGDGVHKTHLPGVGAGQLLDLPLGVKLPLI
PGSKTLYYTTKLSEKLFQPSYGFNLTDPYCRLLENQYKSLHDPHLRAYYKRKDILRRLKK
GGYITSNNKIVCTLRELNKYRQYLTSLKLDFERNYIRDQEMLAKQVNRLQENSQIPRRSD
VARFQNFLLQEGTQSVKDQERLIRHRYLDMINRELEQLEHTGEEQRLIRMDREERRQREY
TRRKLSLRRKIEEEWKNKEMLLLTRIGEDVKREARIEEQRRRSREESDRKKQALLEKKMA
YHLQKMQDNNFKGEEMRNDTFHYRGQGGTYCESYSPKKKKKTYNNINLIYTVGDQRASKE
AYGPASNVIYQSLSSSKTVVKKPATSAGQLEVQVNGTEQKKDRVTRKSSTFDDRGAVFTS
AQNSVISPQASPTRNYPRTSQSYLDPPKNEKEINADWNERTNKRSSYFCESGPHVHATAH
GTLPSHAFSNTEQNLLQNCMREKVTSEELNSIIQNIMTWVVATVTSILYPAITKYEERLR
TKAYPVSDESILSSDSSSFCSTCSEEFTYGSYTSATTKTFQGEPCTFTVDLSIKQPTTPL
KPPSAHVERITVGKTYHVEGQSISSELKYNKTSMTCAYPKLRICKSDSHLLASFETNTKK
SKDATTETDGLESPLFPDQKAKAMNEMKNLKNVFVNFKCHLKGETELILESIFQEIMSDL
TQAIPSISSVTAEVFVEQNEPEKRDLLSNVDICSAASEIVENMLEKLQSAVEKKCVEIFS
QEDLSVDIKPSLPPSRKYLSPSNRKSVKASQPYNLEPMCDIAEDMVHAILEKLMTLASCK
KNELPYLEDAIKLSDQQPMTDPTYMSLERDNKMKHSPEPDAANLIVKDQIQNLMSNIFSQ
SSLVGYIEEAISTILEYVQTELNNERLTASEETVVFLQLLDDIFTQLHQERVNADIQKCR
HSRPRNLSDTEEKYRLTGTRLANGLKSRRLFPPINVPGMVLYSEDDNEEIDKIVENVLDS
SFKDEKPKSQKGVPENWFTKGNTSFEYKRNSKPPTNAASQRSKVAFCDGGLKTELPSFNN
KEILKEKPCLNTDMLIFSRDQQHHIQKASENVVKSILTDMLKDLSSVPPGPLDNKTGKEA
SVLVSEKSQRLSYQEWMDQMFSVSEIRAVSREITDAVLNILHKASRCIPNTTKSSSSSSV
HTSLGTSDTPHMVKEAPNKKSLKVWFDSEKKVKYLSSFNVDPAKPSVSQSEISEPQSIDG
ITDKIINTVFKRLKLFICPKLQMGFKPSVVEKSSLQSQLSTYTTKVVNIVLRAIQNELEL
SKRSLNHRERDDTKSLTGKGFFADTDKLESLVSIMESPLLTCICELLSSGHSDQSNISLP
SDKPKPATSYGSDSTDKQNILPNRQDKKSFYKYLATPCALHSVVNGKDVKDNARLQVLDS
IGETLYEMLLKLIGAHPHHQPPNSKLNREKNENPEMATPLQSNIQLISKTILEYILAKLC
SVDMDTSFASSGFKAVSESFDIDNLSFASIIEEIAKCTDIISRIISRMIQEGNKDVTKHK
EKTIALVSSKTGSTKETHSNELKALASDILNVVFAKLEGFANGNLETLGSINNRNEENNK
TNLEYESPSIFTDTHEELLQSALYMNAKKISSTILKAIQTELNMNSLDLRTSTNTPPPEK
QTLKNIVNLILDAVSADMFNETESEEGSIETYRYRPSYGNFLPGGAESDSFLEDVSHTEK
EFIGERTLLREEAKSDSLKQWVLERMLNKIEVKLKEPQKSPIVPIIRNILNEIFQNALVD
QLNVLSLSHSHLNSIIHNVEGPIPQTSVQFIDKVIGSLVSEADVIVVADDVVRTVFHKLY
SAAMPERNTSENRYKTITFRANVSLQEHTRFSVDKQAKVNVVEDIVQAILTNLETFATSK
VKSLFCPQISFTVPTALSFQQDKSALSKALSAKDLYSDDHLSSCSVDHHITSEKTNSVCQ
LSLNKLNTYATEVARKILQGIKHELDKERESPFSTHNIVVSESIASQVVNTVLDIVSSKG
MCDNSEKEINSDQQEGIIEKLFNKSEYRKVLQFQIQGIIEGILCDIYEKTLYQNNLTCAT
PTLKCSITGKHSRENSEIFIKDANKIIPKLSVPKSDVIFISNDIVDVVLHNLSSTVRLSI
NAKNPTSARLPLTFCDIFSRAECQKPPLMGSKGEIKTEYLPSSRNLKSAYADGCQITTVE
KEDAKKTAPDPCEENANFITKTIFNRLEAFATERIDSLITLAFQSKEKSIASLEQENYKQ
EDSLFHESSQQESNANALKISTKTILSQELTDSTFANYKENVGSTIHLSQASLKEYADII
ASAILKLIKNDLDLEIQKMYPYPNSISFQENIIVSGIVSSILKSLYDKRSAKEISVYSKD
NPKLFSQLTASNEILLGQREQEKNKVSPFSKYPLEQNQVTLGKESQRTVLEEIFMRNGES
KQKEKTALLSGVQEILTKLHQRIMDIIGHLPPFNDIPHLTSNSKIKTSDITQKNFFQSQI
NRVTNDIVESVLGKMYSIVVTSLNENNKKVEAPDNKDTLSKKATCIKETKQAGKGNNPPK
YVTPQGYSYAGRQSVSLLEDKCLQYAPLQLGKDLVEMVLKKIINFASIHLEETLSPESFS
DELLPVKSHNSKVSSKSSSKPDFKTSLKARSKVIPLPKFKTKSYLGPSGAKVKSKTKLGP
GEKTPRDSQSKTTIGLPPTLSTGDAKNLLEMRLPNSELRMYAKDIVSSILETTVKEFEKV
KQTKAMINVKALPSDQIMAANKIVNAVLQGLYATSNHNLAYPIKFSHVDDLRLSQGNSDA
EYLAKPQACFYLENVSSQLEQIFPKEGIFKKMFDKWQAESNDMENEKCKLMMIAENVLTE
IPIKTKELEYSLSLLNLHQLEDCESRCYNHFKGASTRVDDTKAQINMFGREIVEMLFEKL
QLCFLSQIPSPDRKGTLGKRKEYISTKSKYDLPVKDILSSVPIYNTKTVDQISLGSSNQI
VQDIVERVLNILESFVDLQFKYISKYEFSEIVKMPIENFFPLQQGLVSKKMLPKLQPLKK
FPDESNSNTIISKENIQNTILQIHSFHSELVTYAINIVSDMLCIIKNKLDKEISQVEPSS
ISTLKETVIASEIIGTLIDQCIHINNLPKKSLFQGAENAYIVNQVELATYMKMPTSKLKE
DSSGNNPSQISVPGFVCYSEEGMKKRYKPSSKLPSHPRASVEDTIKSSEPMERLDSENIP
SFFKNEVQNYSPRESNFGHFDQLMQGNKSLPEGSVLQKLFKKANESTEAALKQVMSFIEI
GKGENPRVFHFETLKPVETNQIQTTVSPLKISLAAENIVNTVLSSYGFPSQSNIHENMET
RKPFFLSNQNPLSVISGGQKNEEKSLLRMWDKKISYIPEEENKKPEASREDFSLLQKWES
KRSPNGKALKEVKVIAFADHELGPKEIHLVARHISTSLVTYFKNFETRVSSEEKVSIIST
LSRKKCESKQPLRSIYNDSSLNQLCEHLTESIICHLTSSISGNTKDIREREKILESQNVG
FNRIISIDSQTFESRSISVGELALRISDIVTEILFNSNIIEVDNAQQMFPLKTKYIYCPR
AASADFDNLFQDLLTGVIHVMSKEIGINHHLESNGREKSFSMFRRNSVTICNETNTMERQ
KGFRDRKSSNYQTDHLLQKSKLNYLACKLDNLIGTLKTRESKEVVNKVFNIVLDLFLPDE
HPSEAMNCDKKAGTFFPSSDHQQSNSLLGNNLGLTPKSVFLLNIVCEKLIRTLLEKCTNT
VLLDNSPLSNEISAEECKLLKTLQSVEDEEFDFCKGEMDCEQFQGDYMSDFLENLAEMDQ
DLLSSDSMLTVISHSLVKSLMDKLCHSVQLPQSPPSANKPLKYTRKEMQSSFINAKGPEL
TELGQGKAFLGFMSYNGNALTGSLNNPSGVSSKVKAPFGKKCSVNSASVSPLKRQGTKDV
ESIPIHNKLYPGDINTGVYSATFLEEIISELFFNLSTSLWDKNKNITEDWLYEMNTIFVN
NVVNEFNKAQVTVLRNVEERLCFPPIHKETISRIVDSVYYDVLQQYKVKVTCDDNQACDN
TSIAEQITNGILSEILDYQLPSCFRGKLIPNSYYPLQAEIILQKLQNNMRKFTSQFRSST
SYSTMLSHSFLEDIIRRLLSQLIPSPNKASPLGNKYFMSSDFNEMSTCIINKVISAISKH
KIWFTIYDNQYLCTGKNLQKMVDSVYSNIVQMSESLVSIQKSIVSRSPIMTDRIASFIIQ
EIIENHLQPFLCGEGLPRPKTPLDAVSNMVKQVLNEVRESHRFQTPSPLGIYPETFVGEI
VARLLSKIFNPKHDTEIELENMTQKIVNSINSHFSKAKIHFLYDDKEQSYTSVNIDIVDE
LVTSIYRNVLKQHGLDPEVDKESKDSDIFVENITNLIIAAISDYLLHPLFSGDLSSSSHS
ISMAENIVQDILGNISKSTKPSQSLSPYNTLLPYTFLEDMIRVLLSRIFPSASSIVPDRE
TPKDRSRANFNEIASKIISDIRMKISQHEIRFSKNEEETKFVYSEDDVQHLVDSVFKNIS
QNSESQEPFEQNITSSSDIFIDRIAGFIIKHICQQHLQPFVDGNLLPSSAYTYLDNKKKQ
WFYATVYSSTFLEDVVSGVLSKILHRVVGIVQTKPVRDSEDELFDKAEKLIHLIAEEFSN
FEVSILENAEEQLCLPPVEREIVKNIIDKVYSKLLQEHEMEITPDKDFLNDPKTLAARIT
QIILAETFDFQIHPNLVRKLPLKSHSKLNTNVLMKRVQCNITKSRFQRQTSTIYTTMLSH
THLEKIVTQLISQMSPLACRTEHPTTTQSDLSNTVIKLINEIMSIISKHAICIIKHGNGK
QCMISEKDIQSMVNSIYADLSYSNLYQSLTKDKKGISNIPVSKIASFIIKEIFNHHLQSF
LSGDKTLVSSAVDQTDKQNVADPKQRELSFIVNSAFFLEEVISELLCKLLYAFSHNFLAA
ENPDTVKTKITSIVTTLVNSIVQEFTTSEILVADNFDDDMRFSEGYKEIVQKTVNLIYEK
ILDEYKSLIQVYRAIQSDTVCFGRKIYYLLLEEIYDYQVQSLVSGELVSSSYSSPQADNI
IRNVLNVITSDSHTLPSCITVLPRSLLEDMIYKLLVHIFPSPDTESELKEEEVTSDYEFV
DATSKLTDEIIKEISEHEIRLATAEENAETMQLEMIENLVDSICNNILKKSEFQAEVQRG
EDKKGGSFLSKIAGFIMKEIMDHHLQPFLHNEESSSDVSEYGQKPVLSKPGKEKTQPALY
SATFLEDVIVDLVHKFYSLPSITEDSKKKEMLEPDIVGLAIKFANSLIGEFKKSKIKVLP
NAEEMFSFPPIDKETVDKISNFVYDQFIGKYGSSDIQDDKNNVVAEMIVALAQKAISAFK
IQPLFSGDWSSTFFSFLNPDNITQRVQHLPQQTSTQINSCLKGNELALPKQSYKYTSVTT
GQKNVSDTLEIDSSTISRKKSFKTEETSMKKGDIQDPVVTSITTIMKSNMNNMLSVPTAN
VTNENKETENKMEISIKYENVSGVTCPTTSVKHKDRQEPDLRVTLKNNEIEKISISASKD
ERRQGNKLHTQSLVVTDVTVYEEEIPGPNFEINNEKKIDKTRENTSKEEDKPFQLSLTSK
VRNTETTTENILKTVIQKPKKEDEKNLSSQTDINEKQYSDYEYVQNVIENIYDNILVVYP
SPESADYSKPQTPLNDTTSHVIQEVRQDFTQSVSTKDSSLSINSLPIKEKEEKEKVRSTE
RSKETEREKEKEKESKRGKKSEILNNKEIKNEPSKSDSPQYTSKGKPGIVPAKFLEDVII
EMVNKLLFSSSSETRIGDRCQNVSDDGKNQAELYDIAMKFMESLLKEFSDAQIKVFRPHK
GNQFFPPVDKVSSVPKALPRQKETTTDETSSNINKLMVDKVPLMHKMTETLSSNKIPFLD
KIQGIDKTLVNKVVHSSVCNILKEYKSQDSICKNIKNNGENLARRLTSAVINEIFQHQLN
FIFCDEVPTSACLPLESKDVVRKVQKVVQTASKECQPLPPSTIMLPHEFLENVISALLAK
IFSTVSNTEVETSEYNWFTELDFLKMRLLNTVTIAISKDKDMTIQYVEPLHPKDDEIIQL
VIHSIYNNLLSQYGSQEIIQNCVASGCRILSETIVDLVLKEVTGSQLQNYFSGELTPHQC
AEVDSVVENILKDVIQTPDALQPQPSHVRILPYNIIEETAVKFLSKLLSVFPKVDKERTK
SLETDMQKISSKILNSIQEFISKSKIKLVSPAKEFPTVPLANNETIEKVVNSVYASVLKH
SGSHTSVFKDLMSKSNVLSDIIGLLMVKEISNSEFQPQVEDKVSSSGLVLEAVKIMEKVL
KTADESKSQEKSSSKKGSMLDARFLEEALALFLAKIVKLPSASSKDARNLSKPELNKIAS
QLTKSVTAEISQSNINLVAANPEEHLLNPESIEMISQVIDSIYSNVLQQSGTQEELYDDI
KCTNTVFPRKVASFIISGVSQFPLDTVTRKNSNANFFGNLDVDRIIQKAQKHAAIDITHE
LEEEESYQDSTGNSPIKIVPHFGNKPIKIDPEIISEHLAVISVKTQPLEKLKMECLRNTG
HSITELRKASINGRSYSLPDTSNIEKIKRERRSSLNKLGRLDVKPFEVSAKAIVKTSE
Download sequence
Identical sequences M3XWM4
ENSMPUP00000003474 ENSMPUP00000003474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]