SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003498 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003498
Domain Number 1 Region: 10-152
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-34
Family Pleckstrin-homology domain (PH domain) 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003498   Gene: ENSMPUG00000003528   Transcript: ENSMPUT00000003565
Sequence length 778
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:1885099:1905078:1 gene:ENSMPUG00000003528 transcript:ENSMPUT00000003565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGRPRSSLSLASSASTISSLGSLSTKKPPRAVSKVHAFGKRGNALRRDPNLPVHIRGW
LHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYSIRPDGPGAPRGRRFT
FTAEHPGMRTYVLAADTLEDLRGWLRALGRASRAEGDDFGRPRSPPRPQPGEGPGGPGGP
PEVSRGEERHSLESPEVARLSRLRGRPGLLTPSPTADLQSGPRIRRTRSPDLFTPLSRPP
SPLSLPRPRSAPVRRPPPSSGDTAPLARPHTPLSRIDVRPPLDWGPQRQTLSRPPTPRRG
PSSESGGGRPPRSPQHWSQEARTQAPSGSSTYLQLPPRTPGTRASMVLLPGPPLDSTFHQ
SLETDTLLTKLCGQDRLLRMLREEIDQRQEEKEQLEAALELTRQQLGQTAREAAAPGRAW
GRQRLLQDRLVSVRATLCHLTQERERVWDTYSSLEQELGTLRETLEYLLHLGSPQDRASA
QQQLWMVEDTLAGLGGPQKPPPNTEPDSPSPALQAEESSERESLSESLELSSTRLPEADW
GRPPGGDRDLSSPCSGLGSPRISRASSPESRRPASPQAGTKRSLARPRMSAQEQMERIRR
NQEFGRPLPRPASPRLLTLGTTLSPARRQPDTVPRPVQGHSGAPKWLRSSGSWSSPRNTT
PYLPTAEGHRERVLSLSQALATEASQWHRMMTGGNLDSRGDPLPPAPPPPSDPSPQVTSP
PRSPVANSGSAGLSRGGSGRGAGPASWEPTWESGTAPPALTQEEAAWPLRVTLLQSSF
Download sequence
Identical sequences M3XWP8
ENSMPUP00000003498 XP_004767440.1.14098 XP_004767441.1.14098 ENSMPUP00000003498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]