SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003504 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003504
Domain Number 1 Region: 54-108,213-313
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-41
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 2 Region: 6-75,106-126
Classification Level Classification E-value
Superfamily EF-hand 0.0000000122
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003504   Gene: ENSMPUG00000003534   Transcript: ENSMPUT00000003571
Sequence length 604
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:2071111:2095143:1 gene:ENSMPUG00000003534 transcript:ENSMPUT00000003571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRVDSNGNSMLSNEDAFR
LWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVGLGELEELLAQEAQAAQTTGGLS
VWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQL
QPSSLCYFGSEECKEKRGTIPLDAQCCVEVLPDREGKRCMFCVKTATRTYEMSASDTRQR
QEWTAAIQTAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERK
LQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKKEE
AARQRQRIQELEEMQQRLEEALHLEVKARRDEEAVRLAQTRLLEEEEEKLKQLLQLKEEQ
ERYIERAQQEKQELQQEMALQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNV
KHWNVQMNRLMHPIEPGDKRPTTSSSFTGFQPHLLARRDSSLKRLTRWGSQGTRTPSPSS
DLFI
Download sequence
Identical sequences M3XWQ4
ENSMPUP00000003504 ENSMPUP00000003504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]