SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003509 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003509
Domain Number 1 Region: 8-83
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-21
Family PDZ domain 0.0000741
Further Details:      
 
Domain Number 2 Region: 316-345
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000376
Family LIM domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003509   Gene: ENSMPUG00000003539   Transcript: ENSMPUT00000003576
Sequence length 354
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896992.1:5145196:5156273:-1 gene:ENSMPUG00000003539 transcript:ENSMPUT00000003576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVAGPGPWGFRITGGRDFHTPIMVTKVTERGKAEAADLRPGDIILAINGESAEGM
LHAEAQSKIRQSPSPLRLRLDRSRAASPGQTNGDGSVEVLATRFQGSMRTHTDSQSSLRS
SCSSPVSSSPQPGSPFSTLPLSSPHALPGEVMVSRSFQSLAHSPGPIAADRFSYGGRPGN
RQASLTRAGDSAVLVLPPSPGPRSSSPRLSVDSEGGSRLLEEDSEVYKMLQENREARLAP
RQSSSFRLLQEALEAEERGGTPAFLPSQLSPQSSLPTSRALATPPKLHTCEKCTTSIVNH
AVRIQEGRYRHPSCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSSPTTLSS
Download sequence
Identical sequences M3XWQ9
ENSMPUP00000003509 XP_012917272.1.14098 XP_012917273.1.14098 XP_012917274.1.14098 XP_012917275.1.14098 ENSMPUP00000003509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]